BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_F11 (508 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC890.04c |||ribosome biogenesis protein Ytm1 |Schizosaccharom... 26 2.8 SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual 25 4.9 >SPAC890.04c |||ribosome biogenesis protein Ytm1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 440 Score = 26.2 bits (55), Expect = 2.8 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 18 RNSARGEKCPELAGERAP-VSCAQPTSPATDSHYSSDPSGA 137 R E P+ AG R+P + C T P D +S DPS A Sbjct: 245 RRRKNAEFTPQ-AGARSPLILCEGHTGPVMDIVFSDDPSVA 284 >SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 1202 Score = 25.4 bits (53), Expect = 4.9 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -2 Query: 405 TLIIINKKIHPAENELNVETKFNLYKCLNYLL 310 T ++ N+ I + + T NL KC+NY L Sbjct: 593 TFLVYNEGIVKLNKDFDDFTPLNLLKCVNYSL 624 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,725,538 Number of Sequences: 5004 Number of extensions: 28719 Number of successful extensions: 84 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 202220600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -