BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_F10 (488 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0968 + 29277122-29277445,29278389-29278505,29278957-292791... 28 4.6 >03_05_0968 + 29277122-29277445,29278389-29278505,29278957-29279114, 29279678-29279727,29279968-29280161,29280867-29281049, 29281152-29281270,29281383-29281522,29281857-29281937, 29282286-29282389 Length = 489 Score = 27.9 bits (59), Expect = 4.6 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -2 Query: 247 ATHLSTSQCAIIRFK*GGETTPFLVVDDCL 158 + HL A+I+ GG TT FL +D CL Sbjct: 306 SAHLHCKFPAVIQHGEGGPTTKFLALDKCL 335 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,165,357 Number of Sequences: 37544 Number of extensions: 173900 Number of successful extensions: 220 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 220 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 220 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1011709100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -