BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_F09 (340 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g57630.2 68416.m06421 exostosin family protein contains Pfam ... 25 9.7 At3g17740.1 68416.m02264 expressed protein 25 9.7 >At3g57630.2 68416.m06421 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 791 Score = 25.4 bits (53), Expect = 9.7 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +3 Query: 12 ERCNGKK*NSSFKPDGTCENE*GVCQRVTGMSDNSDNNFRID 137 E G+K S G C +E G+C+ G +D S R+D Sbjct: 114 EPIGGRKCMSDCSGQGVCNHEFGLCRCFHGFTDCS-QKLRLD 154 >At3g17740.1 68416.m02264 expressed protein Length = 1149 Score = 25.4 bits (53), Expect = 9.7 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -1 Query: 109 SDIPVTLWQTPHSFSQVPSGLKLEFHFLPLHLSYLV 2 +D+P L H FS V G K + H L L +Y V Sbjct: 934 NDLPGALEILEHMFSSVLPGRKSQSHQLELLFNYYV 969 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,965,621 Number of Sequences: 28952 Number of extensions: 92580 Number of successful extensions: 209 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 209 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 209 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 399440640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -