BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_F06 (236 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT003575-1|AAO39579.1| 994|Drosophila melanogaster LD33058p pro... 26 8.1 AE014297-1603|AAF54881.2| 1013|Drosophila melanogaster CG31342-P... 26 8.1 >BT003575-1|AAO39579.1| 994|Drosophila melanogaster LD33058p protein. Length = 994 Score = 25.8 bits (54), Expect = 8.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 2 SKVRAIYNMGPRESLKNKFPEYDILTLPSQ 91 SK+R + + PRE+L K PE LP++ Sbjct: 155 SKLREMKILSPRENLYTKLPEVRAPLLPTR 184 >AE014297-1603|AAF54881.2| 1013|Drosophila melanogaster CG31342-PA protein. Length = 1013 Score = 25.8 bits (54), Expect = 8.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 2 SKVRAIYNMGPRESLKNKFPEYDILTLPSQ 91 SK+R + + PRE+L K PE LP++ Sbjct: 155 SKLREMKILSPRENLYTKLPEVRAPLLPTR 184 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,651,176 Number of Sequences: 53049 Number of extensions: 138643 Number of successful extensions: 411 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 411 length of database: 24,988,368 effective HSP length: 58 effective length of database: 21,911,526 effective search space used: 438230520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -