BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_F05 (364 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 5.9 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 20 7.8 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 20.6 bits (41), Expect = 5.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 265 FV*DSQNLLSNIVQISN 315 F+ D L+ IVQISN Sbjct: 406 FISDDNQKLTGIVQISN 422 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 20.2 bits (40), Expect = 7.8 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +3 Query: 189 VMGFAFILTHGELHS*EQIILPMMIFCLRFTKLTI 293 V G+A I+ + S +++ ++ R+TK TI Sbjct: 205 VEGYALIIYNNADDSFQRLTSSTFVYDPRYTKYTI 239 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,245 Number of Sequences: 438 Number of extensions: 1254 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8556345 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -