BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_F02 (418 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19A8.02 |||transcriptional coactivator |Schizosaccharomyces ... 26 2.7 SPCC18B5.01c |bfr1|hba2, SPCPJ732.04c|brefeldin A efflux transpo... 24 8.2 >SPAC19A8.02 |||transcriptional coactivator |Schizosaccharomyces pombe|chr 1|||Manual Length = 1213 Score = 25.8 bits (54), Expect = 2.7 Identities = 8/31 (25%), Positives = 20/31 (64%) Frame = -1 Query: 217 LSYP*ILYYVFIQYIYNKIFSVL*FYCIFVI 125 L P ++++F++Y+++ F V+ F C ++ Sbjct: 1006 LKLPWAVFHIFLRYLFSHSFLVIIFACSVIL 1036 >SPCC18B5.01c |bfr1|hba2, SPCPJ732.04c|brefeldin A efflux transporter Bfr1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1530 Score = 24.2 bits (50), Expect = 8.2 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = -1 Query: 190 VFIQYIYNKIFSVL*FYCIFVILFYRYVFESNKTIET 80 +F+ Y++ IF+VL + +F ++ R + K T Sbjct: 1493 IFVGYVFFNIFAVLLLFYVFRVMKLRSTWLGKKITGT 1529 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,535,540 Number of Sequences: 5004 Number of extensions: 30623 Number of successful extensions: 53 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 146319408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -