BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_E23 (499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32805| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 38 0.006 SB_7378| Best HMM Match : SCP (HMM E-Value=3.3e-29) 33 0.099 SB_57943| Best HMM Match : SCP (HMM E-Value=5.70048e-42) 33 0.17 SB_47116| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.23 SB_887| Best HMM Match : SCP (HMM E-Value=7.1e-25) 32 0.30 SB_9137| Best HMM Match : SCP (HMM E-Value=3.6e-18) 31 0.40 SB_8749| Best HMM Match : SCP (HMM E-Value=4.9e-16) 31 0.53 SB_8748| Best HMM Match : Astacin (HMM E-Value=0) 31 0.70 SB_7926| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_41991| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.92 SB_59700| Best HMM Match : SCP (HMM E-Value=1.6e-14) 30 1.2 SB_55473| Best HMM Match : SCP (HMM E-Value=1.6e-22) 30 1.2 SB_11891| Best HMM Match : F5_F8_type_C (HMM E-Value=4.7e-35) 30 1.2 SB_4646| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_12270| Best HMM Match : Big_2 (HMM E-Value=8.1) 29 2.8 SB_27401| Best HMM Match : SCP (HMM E-Value=9e-23) 28 3.7 SB_41| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) 28 4.9 SB_3100| Best HMM Match : SCP (HMM E-Value=1.5e-20) 28 4.9 SB_21314| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_32805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 37.9 bits (84), Expect = 0.005 Identities = 21/57 (36%), Positives = 29/57 (50%) Frame = +2 Query: 323 GENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAW 493 GENLY TT T D A++SW++E +Y Y + IGH+TQ+ W Sbjct: 126 GENLYNKGTTSGTVSTCQD-AVDSWYSEIDNYDYTDYT----NHPGGVIGHFTQIVW 177 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 37.5 bits (83), Expect = 0.006 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = +2 Query: 362 YKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAW 493 Y L D A E W++E KDY + L + K GH+TQ+ W Sbjct: 3699 YDLRGDKAAEMWYDEVKDYNFETLAYN------AKCGHFTQLVW 3736 >SB_7378| Best HMM Match : SCP (HMM E-Value=3.3e-29) Length = 264 Score = 33.5 bits (73), Expect = 0.099 Identities = 24/90 (26%), Positives = 33/90 (36%) Frame = +2 Query: 224 WDEELXXXXXXXXXQNKNFHNPDKTLGSGRFQTGENLYWYSTTDSTYKLNVDNAMESWFN 403 W +EL + + + R GENL +S Y D A E W+ Sbjct: 140 WSDELAREAQYYAEKLAQQRSMQHSSKCSRNDAGENLAMFS---GRYDTAGDMACEMWYE 196 Query: 404 EYKDYKYAPLKQSDFDKSKPKIGHYTQMAW 493 E K Y + + F GH+TQM W Sbjct: 197 ESKKYSFV---RGGFQGGT---GHFTQMVW 220 >SB_57943| Best HMM Match : SCP (HMM E-Value=5.70048e-42) Length = 632 Score = 32.7 bits (71), Expect = 0.17 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = +2 Query: 317 QTGENLY-WYSTTDSTYKLNVDNAMESWFNEYKDYKYA-PLKQSDFDKSKPKIGHYTQMA 490 Q GEN+Y + D +N + A++ W+NE +Y + P QS+ GH+TQ+ Sbjct: 53 QDGENIYVQFGQAD----INGEEAVDKWYNEVNNYDFGKPGFQSN-------TGHFTQVV 101 Query: 491 WSE 499 W + Sbjct: 102 WRD 104 >SB_47116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 32.3 bits (70), Expect = 0.23 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 362 YKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYT 481 Y+ N + ++ WF+E + Y Y K S + +P GHYT Sbjct: 44 YQKNPTDGVQDWFDERQHYTYG--KHSPRNCRRPSCGHYT 81 >SB_887| Best HMM Match : SCP (HMM E-Value=7.1e-25) Length = 147 Score = 31.9 bits (69), Expect = 0.30 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +2 Query: 323 GENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAW 493 GENLY S ++ +N + ++ W++E YK+ D + GH+TQ+ W Sbjct: 59 GENLYMCSPSE----INAGDIVDEWYSEISKYKF------DKPGWQSGTGHFTQVVW 105 >SB_9137| Best HMM Match : SCP (HMM E-Value=3.6e-18) Length = 708 Score = 31.5 bits (68), Expect = 0.40 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +2 Query: 320 TGENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAW 493 +GEN+ + L A+E W+NE + Y +A + + PK H+ QM W Sbjct: 591 SGENIAQLRANPDSLHL-ARKAVELWYNEVRSYSFA------YPQLTPKDRHFVQMIW 641 >SB_8749| Best HMM Match : SCP (HMM E-Value=4.9e-16) Length = 369 Score = 31.1 bits (67), Expect = 0.53 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +2 Query: 323 GENL-YWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAW 493 GENL Y DS + +V +E+W+NE K Y + SD GH+TQ+ W Sbjct: 284 GENLGYSCVKPDSGHDCSV--TVEAWYNEVKKYDFNSPGFSD------PTGHFTQVVW 333 >SB_8748| Best HMM Match : Astacin (HMM E-Value=0) Length = 757 Score = 30.7 bits (66), Expect = 0.70 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = +2 Query: 323 GENLYWYSTT-DSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAW 493 GENL W D Y + A W+NE KDY + F + GH+TQ+ W Sbjct: 660 GENLAWGCFPGDKVY--SCVKATTEWYNEVKDYDF---NNPGFSGA---TGHFTQVVW 709 >SB_7926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 30.7 bits (66), Expect = 0.70 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = +2 Query: 323 GENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAW 493 GENL + DS Y+L+ E W++E + Y++ F GH+TQ+ W Sbjct: 24 GENLSF----DSGYELSGGRTTEMWYDEIQKYRF---NNPGFSSG---TGHFTQVVW 70 >SB_41991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 30.3 bits (65), Expect = 0.92 Identities = 18/56 (32%), Positives = 31/56 (55%) Frame = +2 Query: 317 QTGENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQ 484 Q GENLY + S+ + ++A + W+ E DY + + +++S IGH+TQ Sbjct: 731 QYGENLY--GSVSSSGAGSCEDATDLWYAEIADYDW-----NYYNQSTGVIGHFTQ 779 >SB_59700| Best HMM Match : SCP (HMM E-Value=1.6e-14) Length = 427 Score = 29.9 bits (64), Expect = 1.2 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = +2 Query: 317 QTGENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYA-PLKQSDFDKSKPKIGHYTQMAW 493 Q GEN S + +L + A + W+N+ Y Y+ P SD D +TQ+ W Sbjct: 300 QLGENRAKLSAVNYDCELAGEEAAKIWYNQGSHYSYSDPRLNSDTDS-------FTQLVW 352 Query: 494 SE 499 E Sbjct: 353 KE 354 >SB_55473| Best HMM Match : SCP (HMM E-Value=1.6e-22) Length = 141 Score = 29.9 bits (64), Expect = 1.2 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +2 Query: 311 RFQTGENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMA 490 R+ GEN+ S + ++ +A++ W+NE + Y+Y D GH+TQ+ Sbjct: 71 RYYKGENICRMS-----HHFDIGDALQIWYNESESYQY------DNPGFALTTGHFTQIV 119 Query: 491 W 493 W Sbjct: 120 W 120 >SB_11891| Best HMM Match : F5_F8_type_C (HMM E-Value=4.7e-35) Length = 1171 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +3 Query: 300 WDREDSRLVKICIGIQRPIAHTN*MWTTLWRVG 398 WD + +V+ C G RPI +W+ L++ G Sbjct: 115 WDYMEDNIVRFCEGTIRPILSEEGVWSPLYKSG 147 >SB_4646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 329 Score = 29.5 bits (63), Expect = 1.6 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 186 DT*PLASNCLL*LCPL-TKSLICLHDKFSRDLLWTCP 79 D P + +L +CP T+ ++ + +F+RD+L TCP Sbjct: 82 DLCPRGTRDMLEMCPRGTRDMLVMCPRFNRDMLETCP 118 >SB_12270| Best HMM Match : Big_2 (HMM E-Value=8.1) Length = 112 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/19 (52%), Positives = 17/19 (89%) Frame = +3 Query: 405 NIKITNMLP*NRVTSTSLN 461 N+K+TN++P +RVTS ++N Sbjct: 46 NVKLTNIMPSSRVTSVTIN 64 >SB_27401| Best HMM Match : SCP (HMM E-Value=9e-23) Length = 1105 Score = 28.3 bits (60), Expect = 3.7 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +2 Query: 371 NVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAW 493 ++++A+ W+NE Y +A +P H+TQM W Sbjct: 606 SINDAINKWYNEVCKYDFAS------GGPQPGANHFTQMVW 640 >SB_41| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 28.3 bits (60), Expect = 3.7 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -2 Query: 147 CPLTKSLICLHDKFSRDLLWTCPIHTTI 64 CP TK+ C H+K ++ + CP + Sbjct: 235 CPFTKATCCTHNKCCKEGTFCCPTEPAV 262 >SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) Length = 2123 Score = 27.9 bits (59), Expect = 4.9 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +2 Query: 383 AMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAW 493 A+++W +E KD+ ++ KQ DK ++ H+TQ+ W Sbjct: 1367 AIKAWHDEEKDFDWSSGKQ---DKD-AEVVHFTQVIW 1399 >SB_3100| Best HMM Match : SCP (HMM E-Value=1.5e-20) Length = 191 Score = 27.9 bits (59), Expect = 4.9 Identities = 15/59 (25%), Positives = 28/59 (47%) Frame = +2 Query: 323 GENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSE 499 GENL + ++ L + A+ W++E Y + KQ + + GH+T + W + Sbjct: 74 GENLIYRCSSGPGEVLPAEKAVTDWYDEICMYNF---KQPGY---YSRTGHFTALVWKD 126 >SB_21314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 586 Score = 27.1 bits (57), Expect = 8.6 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +2 Query: 374 VDNAMESWFNEYKDYKYAPLKQSDFDKSK 460 VD++++SWF++Y D+ ++F+ K Sbjct: 288 VDSSVKSWFDDYMDWAKVSKPAANFNAGK 316 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,761,946 Number of Sequences: 59808 Number of extensions: 307456 Number of successful extensions: 649 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 647 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -