BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_E20 (153 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19050| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.5 SB_10408| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.3 >SB_19050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 25.8 bits (54), Expect = 5.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 48 ITMTWKLWKPSEYH*GFFMSVIITCY 125 I + W LW +FM+V+I C+ Sbjct: 158 IAIWWVLWVEDHAAFAYFMTVVIVCF 183 >SB_10408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 25.4 bits (53), Expect = 7.3 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +2 Query: 23 LIKVCKASYYYDMEIVETFRISLRFFYVRHNHML*ITSSYI 145 LIK+ K Y+ + + + + + Y H H L +SS+I Sbjct: 103 LIKIIKILYHRHLHLSKLSKSVIIIIYQNHQHPLSSSSSFI 143 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,581,759 Number of Sequences: 59808 Number of extensions: 67610 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 16,821,457 effective HSP length: 30 effective length of database: 15,027,217 effective search space used: 300544340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -