BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_E19 (323 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0388 - 18486957-18487016,18487286-18489418,18489985-184904... 28 1.9 >12_02_0388 - 18486957-18487016,18487286-18489418,18489985-18490484, 18490728-18490899 Length = 954 Score = 27.9 bits (59), Expect = 1.9 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Frame = +1 Query: 217 CFVI---YLHLTL*WISTVLHCLVKLIKTYYYNL 309 CF I YL L+ W+ T+ + KL+ YY NL Sbjct: 556 CFFISLQYLDLSRNWLKTIPSEVCKLVNLYYLNL 589 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,373,597 Number of Sequences: 37544 Number of extensions: 94695 Number of successful extensions: 172 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 167 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 172 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 423156300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -