BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_E18 (379 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC131799-1|AAI31800.1| 447|Homo sapiens 5-hydroxytryptamine (se... 29 5.0 AF459285-1|AAL66182.1| 447|Homo sapiens 5-hydroxytryptamine rec... 29 5.0 >BC131799-1|AAI31800.1| 447|Homo sapiens 5-hydroxytryptamine (serotonin) receptor 3, family member C protein. Length = 447 Score = 29.1 bits (62), Expect = 5.0 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Frame = -2 Query: 198 LCLQL-IMSGLYLVVITYLLHLKTIYTQSLKGPPLIQFLDNYLL 70 LCL L ++S L V ITYLLH+ T TQ PP+ ++L + LL Sbjct: 314 LCLSLMVVSLLETVFITYLLHVAT--TQP---PPMPRWLHSLLL 352 >AF459285-1|AAL66182.1| 447|Homo sapiens 5-hydroxytryptamine receptor 3 subunit C protein. Length = 447 Score = 29.1 bits (62), Expect = 5.0 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Frame = -2 Query: 198 LCLQL-IMSGLYLVVITYLLHLKTIYTQSLKGPPLIQFLDNYLL 70 LCL L ++S L V ITYLLH+ T TQ PP+ ++L + LL Sbjct: 314 LCLSLMVVSLLETVFITYLLHVAT--TQP---PPMPRWLHSLLL 352 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,527,271 Number of Sequences: 237096 Number of extensions: 949956 Number of successful extensions: 2012 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1952 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2012 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2536788584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -