BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_E18 (379 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g38880.1 68418.m04702 expressed protein 26 7.2 At3g43890.1 68416.m04698 DC1 domain-containing protein contains ... 26 7.2 >At5g38880.1 68418.m04702 expressed protein Length = 796 Score = 26.2 bits (55), Expect = 7.2 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -2 Query: 138 LKTIYTQSLKGPP-LIQFLDNYLLQTK 61 +KT+ SL+GPP L+Q + Y L+ K Sbjct: 307 MKTVIVNSLRGPPLLLQAIAAYTLRIK 333 >At3g43890.1 68416.m04698 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 661 Score = 26.2 bits (55), Expect = 7.2 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 59 FFVCNR*LSKN*IKGGPFKLCVYIVFKCNKY 151 FFVCN + K KG F Y F C KY Sbjct: 94 FFVCNDCVLKPRRKGSRFGGSSYFHFNCAKY 124 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,732,850 Number of Sequences: 28952 Number of extensions: 142128 Number of successful extensions: 232 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 232 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 232 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 517767328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -