BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_E16 (492 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 5.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.1 AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 21 9.4 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.4 bits (43), Expect = 5.4 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -2 Query: 203 STAQHLQQPLSVWLRFSXXXXXXXHLPG*GRSKHKLIQLLM 81 S++ ++P S+ R S + G + KHK+ LLM Sbjct: 107 SSSSDDERPNSIHQRASFSLNTDGDIAGLRKKKHKVNPLLM 147 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 7.1 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 233 PPRPLQIDQASTAQHLQQPLSV 168 PP Q D +S+++ + P+SV Sbjct: 441 PPLSPQSDSSSSSRSAESPMSV 462 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 20.6 bits (41), Expect = 9.4 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 73 KCYTCKSPKGLSSGRTSTFDFSLV 2 +CYT K L + + FDF ++ Sbjct: 66 QCYTTCIMKLLRTFKNGNFDFDMI 89 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,290 Number of Sequences: 438 Number of extensions: 1669 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13544190 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -