BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_E13 (432 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 4.5 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 21 4.5 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 4.5 AB264332-1|BAF44087.1| 58|Apis mellifera ecdysone-induced prot... 21 4.5 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 4.5 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +2 Query: 335 MRDPPEGDVIRPDAEPAYVRPSQADSVRKQ 424 ++D EG+V ++E + + +DSV K+ Sbjct: 294 VKDVEEGNVEETNSEETHQKDGSSDSVIKR 323 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +2 Query: 335 MRDPPEGDVIRPDAEPAYVRPSQADSVRKQ 424 ++D EG+V ++E + + +DSV K+ Sbjct: 209 VKDVEEGNVEETNSEETHQKDGSSDSVIKR 238 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +2 Query: 335 MRDPPEGDVIRPDAEPAYVRPSQADSVRKQ 424 ++D EG+V ++E + + +DSV K+ Sbjct: 528 VKDVEEGNVEETNSEETHQKDGSSDSVIKR 557 >AB264332-1|BAF44087.1| 58|Apis mellifera ecdysone-induced protein 75 protein. Length = 58 Score = 21.4 bits (43), Expect = 4.5 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +2 Query: 347 PEGDVIRPDAEP 382 P GD++ P +EP Sbjct: 18 PSGDILSPSSEP 29 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 4.5 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +2 Query: 347 PEGDVIRPDAEP 382 P GD++ P +EP Sbjct: 18 PSGDILSPSSEP 29 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,273 Number of Sequences: 438 Number of extensions: 2106 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11244597 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -