BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_E12 (288 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56509| Best HMM Match : Ebp2 (HMM E-Value=2.1) 27 1.9 SB_7587| Best HMM Match : zf-C2H2 (HMM E-Value=3.5e-13) 27 2.5 SB_38395| Best HMM Match : TAFII28 (HMM E-Value=2.9) 27 3.3 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.3 SB_37102| Best HMM Match : zf-C2H2 (HMM E-Value=0) 26 5.8 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 26 5.8 SB_24384| Best HMM Match : I-set (HMM E-Value=4.3e-31) 26 5.8 SB_19167| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.8 SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) 26 5.8 SB_7335| Best HMM Match : TSP_1 (HMM E-Value=0) 25 7.7 >SB_56509| Best HMM Match : Ebp2 (HMM E-Value=2.1) Length = 298 Score = 27.5 bits (58), Expect = 1.9 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 242 TCSFCGKDAMKRS 204 TC+FCGKDA K S Sbjct: 243 TCNFCGKDARKTS 255 >SB_7587| Best HMM Match : zf-C2H2 (HMM E-Value=3.5e-13) Length = 351 Score = 27.1 bits (57), Expect = 2.5 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -2 Query: 287 RKMVKKMEVTQHAKYTCSFCGK 222 +K ++ E++ H KY CS CGK Sbjct: 214 KKQIQSNEIS-HKKYVCSTCGK 234 >SB_38395| Best HMM Match : TAFII28 (HMM E-Value=2.9) Length = 292 Score = 26.6 bits (56), Expect = 3.3 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 103 LTADLHDEAAVVENTQAP 156 +TADLHD A VV N + P Sbjct: 247 ITADLHDTARVVVNLRTP 264 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 26.6 bits (56), Expect = 3.3 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 103 LTADLHDEAAVVENTQAP 156 +TADLHD A VV N + P Sbjct: 972 ITADLHDTARVVVNLRTP 989 >SB_37102| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 618 Score = 25.8 bits (54), Expect = 5.8 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 287 RKMVKKMEVTQHAKYTCSFCGKDAMKRS 204 R+ VK + + + KY C C KD + S Sbjct: 410 REQVKDLFIKEGEKYRCRLCSKDFTRLS 437 >SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) Length = 889 Score = 25.8 bits (54), Expect = 5.8 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +1 Query: 115 LHDEAAVV--ENTQAPPATVLLHRLHDQMPTHERFMASLPQNEQVY 246 LHD AA V + + P T+ LH +PT+ R + P+ Y Sbjct: 409 LHDAAASVYTASNEPPEFTIELHHELGYLPTYPRKVTIRPRKVPTY 454 >SB_24384| Best HMM Match : I-set (HMM E-Value=4.3e-31) Length = 1399 Score = 25.8 bits (54), Expect = 5.8 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -2 Query: 236 SFCGKDAMKRSCVGIWSCKRCKRTVAGGAWVFSTTAASSCRSAVRRL 96 S C KDA ++ VG ++C RCK G + S+CR +RL Sbjct: 911 SACHKDAACQNTVGSYAC-RCKEGYEGDGY-------SNCRVEKKRL 949 >SB_19167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 25.8 bits (54), Expect = 5.8 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Frame = +1 Query: 88 TSRNLLTADLHDEAAVVENT----QAPPATVLLHRLHDQMPTHER 210 T++N A+ H+E + Q PPA H ++Q PTH R Sbjct: 109 TNKNHSPAESHEERPWKNHDSLEHQPPPAEENTHHEYNQQPTHVR 153 >SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) Length = 960 Score = 25.8 bits (54), Expect = 5.8 Identities = 10/39 (25%), Positives = 17/39 (43%) Frame = -2 Query: 233 FCGKDAMKRSCVGIWSCKRCKRTVAGGAWVFSTTAASSC 117 +C C+ W+ KRC + G + F+ T +C Sbjct: 594 YCDHVTGSCECLPGWTGKRCDQACPSGTYGFNCTLPCAC 632 >SB_7335| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 2681 Score = 25.4 bits (53), Expect = 7.7 Identities = 12/54 (22%), Positives = 21/54 (38%) Frame = -2 Query: 263 VTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKRTVAGGAWVFSTTAASSCRSAVR 102 + QH C + G D +++C + CK + +W + C VR Sbjct: 1224 IPQHGGQLCDYIGPDTERKAC----TFGPCKTDGSWSSWTEWSDCTQECGDGVR 1273 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,047,114 Number of Sequences: 59808 Number of extensions: 112070 Number of successful extensions: 413 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 413 length of database: 16,821,457 effective HSP length: 70 effective length of database: 12,634,897 effective search space used: 315872425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -