BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_E11 (459 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC576.09 |rps20||40S ribosomal protein S20|Schizosaccharomyces... 185 3e-48 SPBC211.01 |rsm10|SPBC23E6.11|mitochondrial ribosomal protein su... 29 0.34 SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 28 0.60 SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosa... 27 1.4 SPBC1685.05 |||serine protease |Schizosaccharomyces pombe|chr 2|... 27 1.8 SPBC21C3.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 26 3.2 SPAP27G11.12 |||human down-regulated in multiple cancers-1 homol... 25 7.3 SPBP8B7.18c |||phosphomethylpyrimidine kinase|Schizosaccharomyce... 25 7.3 SPBC31F10.10c |||zf-MYND type zinc finger protein|Schizosaccharo... 25 7.3 SPBC1289.04c |pob1||Boi family protein|Schizosaccharomyces pombe... 24 9.7 SPBC1105.14 |rsv2||transcription factor Rsv2|Schizosaccharomyces... 24 9.7 SPCC550.07 |||acetamidase |Schizosaccharomyces pombe|chr 3|||Manual 24 9.7 >SPCC576.09 |rps20||40S ribosomal protein S20|Schizosaccharomyces pombe|chr 3|||Manual Length = 118 Score = 185 bits (450), Expect = 3e-48 Identities = 87/110 (79%), Positives = 101/110 (91%) Frame = +2 Query: 110 EKPQAEISPIHRIRITLTSRNVRSLEKVCSDLINGAKKQKLRVKGPVRMPTKVLRITTRK 289 +K Q S +HRIRITLTSRNVR+LEKVCSDL+N AK ++LRVKGPVR+PTK+L+ITTRK Sbjct: 8 QKEQQIPSTVHRIRITLTSRNVRNLEKVCSDLVNRAKDKQLRVKGPVRLPTKILKITTRK 67 Query: 290 TPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIA 439 TP GEGSKTW+ ++MRIHKR+IDLHSPSEIVKQITSI+IEPGVEVEVTIA Sbjct: 68 TPNGEGSKTWETYEMRIHKRLIDLHSPSEIVKQITSIHIEPGVEVEVTIA 117 >SPBC211.01 |rsm10|SPBC23E6.11|mitochondrial ribosomal protein subunit S10|Schizosaccharomyces pombe|chr 2|||Manual Length = 224 Score = 29.1 bits (62), Expect = 0.34 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +2 Query: 227 KLRVKGPVRMPTKVLRITTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEI 379 K+ +KGP +P KV T ++P S + + F+ H R+I L+S + + Sbjct: 92 KIPIKGPRPLPNKVESWTLLRSPFIHKS-SQENFERITHSRLIQLYSVNPV 141 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 28.3 bits (60), Expect = 0.60 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +2 Query: 92 VSGKDIEKPQAEISPIHRIRITLTSRNVRSLEKVCSDLINGAKKQKLRVK 241 +S IEKP+A SPIH + +R L+ V GA++ + VK Sbjct: 891 LSSSLIEKPRASSSPIHH----ANNNGLRLLKDVLKKTYRGARENRSSVK 936 >SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosaccharomyces pombe|chr 2|||Manual Length = 548 Score = 27.1 bits (57), Expect = 1.4 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 83 AAVVSGKDIEKPQAEISPIHRIRITLTSRNVRS 181 A V + D+EKPQ +++ R+ L S N R+ Sbjct: 491 ANVTTSADVEKPQVKVATSSRVDYDLKSPNQRT 523 >SPBC1685.05 |||serine protease |Schizosaccharomyces pombe|chr 2|||Manual Length = 997 Score = 26.6 bits (56), Expect = 1.8 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 3/73 (4%) Frame = +2 Query: 227 KLRVKGPVRMPTKV---LRITTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITS 397 K R G + P V LR KT G G + ++ R+ DLH E +I + Sbjct: 785 KSRENGTIPRPLYVISHLRPLLHKTSLGVGDILLE-VNGKMITRLSDLHE-FETESEIKA 842 Query: 398 INIEPGVEVEVTI 436 + + G+E+E+TI Sbjct: 843 VILRDGIEMEITI 855 >SPBC21C3.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 841 Score = 25.8 bits (54), Expect = 3.2 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +2 Query: 332 MRIHKRVIDLHSPSEIVKQITSINIEPGV 418 +R+H+R I L + S+ ++ + NIE G+ Sbjct: 406 LRVHERAIKLRTLSDSIRADVAENIEMGI 434 >SPAP27G11.12 |||human down-regulated in multiple cancers-1 homolog 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 797 Score = 24.6 bits (51), Expect = 7.3 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 292 CFTCCDAENLGRHSDWTLYTEF 227 C+ C A+NL HS +L+ F Sbjct: 469 CYLCLYAQNLNSHSSQSLFELF 490 >SPBP8B7.18c |||phosphomethylpyrimidine kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 551 Score = 24.6 bits (51), Expect = 7.3 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 343 VDAHLESVPSLGTLTARCFTCCDAENLG 260 + A L+++ SLG TC AEN G Sbjct: 52 IQADLKTMTSLGVYGMSAITCLVAENAG 79 >SPBC31F10.10c |||zf-MYND type zinc finger protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 574 Score = 24.6 bits (51), Expect = 7.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 284 RKTPCGEGSKTWDRFQM 334 R +P GSKTW+ FQ+ Sbjct: 427 RMSPLRSGSKTWNIFQL 443 >SPBC1289.04c |pob1||Boi family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 871 Score = 24.2 bits (50), Expect = 9.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 353 IDLHSPSEIVKQITSINIEPGVEVEVT 433 ID SPS I ++ S N+E G VT Sbjct: 545 IDGESPSSISSRLPSSNLEQGSSSSVT 571 >SPBC1105.14 |rsv2||transcription factor Rsv2|Schizosaccharomyces pombe|chr 2|||Manual Length = 637 Score = 24.2 bits (50), Expect = 9.7 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +3 Query: 42 KVVYLDRNIATTWQPLSCQERISRSPRLRSH 134 K +Y D ++ P Q R+ ++P +R+H Sbjct: 322 KNLYTDNKDSSLVSPTGLQSRMEQNPEVRAH 352 >SPCC550.07 |||acetamidase |Schizosaccharomyces pombe|chr 3|||Manual Length = 533 Score = 24.2 bits (50), Expect = 9.7 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -1 Query: 306 PSPQGVLRVVMRRTLVGIRTGPFTR 232 P PQ ++ + L G+ PF R Sbjct: 176 PQPQAIMHLETSSNLTGVTVNPFNR 200 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,007,265 Number of Sequences: 5004 Number of extensions: 40416 Number of successful extensions: 101 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 172312850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -