BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_E11 (459 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_02_0040 + 4482853-4482988,4483111-4483224,4485372-4485514 171 2e-43 03_02_0370 + 7853646-7853772,7854508-7854621,7855152-7855294 170 4e-43 06_01_0239 - 1819316-1819458,1820578-1820691,1820794-1820923 169 7e-43 03_02_0020 - 5045900-5046211,5046233-5046290,5046604-5047242,504... 54 7e-08 06_01_0379 - 2723365-2723490,2724558-2724647,2724813-2725046,272... 30 1.0 01_05_0790 + 25253363-25254136,25259037-25259897 28 3.1 07_01_0344 - 2490700-2493249 27 5.5 01_06_1839 - 40245862-40246022,40246872-40246977,40247868-402479... 27 5.5 02_05_0551 + 29907768-29907909,29907995-29909280 27 9.6 >10_02_0040 + 4482853-4482988,4483111-4483224,4485372-4485514 Length = 130 Score = 171 bits (416), Expect = 2e-43 Identities = 80/121 (66%), Positives = 99/121 (81%) Frame = +2 Query: 80 AAAVVSGKDIEKPQAEISPIHRIRITLTSRNVRSLEKVCSDLINGAKKQKLRVKGPVRMP 259 A + G + +A ++RIRITL+S+NV++LEKVC+DL+ GAK ++LRVKGPVR+P Sbjct: 9 AGGAMKGGKLGMEEARELQLNRIRITLSSKNVKNLEKVCADLVKGAKDKQLRVKGPVRIP 68 Query: 260 TKVLRITTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIA 439 TKVL ITTRK+PCGEG+ TWDRF+ RIHKRVIDL S ++VKQITSI IEPGVEVEVTIA Sbjct: 69 TKVLHITTRKSPCGEGTNTWDRFEFRIHKRVIDLISSPDVVKQITSITIEPGVEVEVTIA 128 Query: 440 D 442 D Sbjct: 129 D 129 >03_02_0370 + 7853646-7853772,7854508-7854621,7855152-7855294 Length = 127 Score = 170 bits (414), Expect = 4e-43 Identities = 84/126 (66%), Positives = 102/126 (80%), Gaps = 4/126 (3%) Frame = +2 Query: 77 MAAAVV----SGKDIEKPQAEISPIHRIRITLTSRNVRSLEKVCSDLINGAKKQKLRVKG 244 MAAA V G + +A ++RIRITL+S+NV++LEKVC+DL+ GAK ++LRVKG Sbjct: 1 MAAAAVYGGMKGGKLGVEEAHELQLNRIRITLSSKNVKNLEKVCADLVKGAKDKQLRVKG 60 Query: 245 PVRMPTKVLRITTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEV 424 PVR+PTKVL ITTRK+PCGEG+ TWDRF+ RIHKRVIDL S ++VKQITSI IEPGVEV Sbjct: 61 PVRIPTKVLHITTRKSPCGEGTNTWDRFEFRIHKRVIDLISSPDVVKQITSITIEPGVEV 120 Query: 425 EVTIAD 442 EVTIAD Sbjct: 121 EVTIAD 126 >06_01_0239 - 1819316-1819458,1820578-1820691,1820794-1820923 Length = 128 Score = 169 bits (412), Expect = 7e-43 Identities = 76/101 (75%), Positives = 92/101 (91%) Frame = +2 Query: 140 HRIRITLTSRNVRSLEKVCSDLINGAKKQKLRVKGPVRMPTKVLRITTRKTPCGEGSKTW 319 HRIRITL+S++V++LEKVC DL+ GAK + L+VKGPVRMPTKVL ITTRK+PCGEG+ TW Sbjct: 27 HRIRITLSSKSVKNLEKVCGDLVKGAKDKSLKVKGPVRMPTKVLHITTRKSPCGEGTNTW 86 Query: 320 DRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIAD 442 DRF+MR+HKRVIDL S +++VKQITSI IEPGVEVEVTI+D Sbjct: 87 DRFEMRVHKRVIDLVSSADVVKQITSITIEPGVEVEVTISD 127 >03_02_0020 - 5045900-5046211,5046233-5046290,5046604-5047242, 5048475-5048515,5048672-5048728,5048952-5049140 Length = 431 Score = 53.6 bits (123), Expect = 7e-08 Identities = 31/104 (29%), Positives = 53/104 (50%), Gaps = 1/104 (0%) Frame = +2 Query: 128 ISPIHRIRITLTSRNVRSLEKVCSDLINGAKKQKLRVKGPVRMPTKVLRITTRKTPCGEG 307 ++P +IRI L S V +E C +I AK + GPV +PTK +P Sbjct: 329 LAPKQKIRIKLRSYWVPLIEDSCKKIIEAAKTTNAKTMGPVPLPTKRRVYCVLNSPHVHK 388 Query: 308 SKTWDRFQMRIHKRVIDLHSP-SEIVKQITSINIEPGVEVEVTI 436 + F++R H+R+ID+ P ++ + + + + GV+VEV + Sbjct: 389 DSRF-HFEIRTHQRLIDIMYPTAQTIDSLMQLQLPAGVDVEVKL 431 >06_01_0379 - 2723365-2723490,2724558-2724647,2724813-2725046, 2725174-2725470 Length = 248 Score = 29.9 bits (64), Expect = 1.0 Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -2 Query: 326 ICPKSWNPHRKVFYV-L*CGEPWSAFGLDPLHG 231 +CP W+ HR+ F++ + C P++ G L+G Sbjct: 183 VCPAYWSAHRRWFFMSMICLNPFTCIGRSKLNG 215 >01_05_0790 + 25253363-25254136,25259037-25259897 Length = 544 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 255 CRPRFSASQHVKHLAVRVPRLGTDSRCASTSV 350 C P SA+ +KH A++ LGTD+ A +V Sbjct: 211 CGPGGSAAPALKHKALQAEALGTDNAMADVAV 242 >07_01_0344 - 2490700-2493249 Length = 849 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 144 RWIGEISAWGFSISFPDTTAAA 79 RWIG+ S F++S P T A A Sbjct: 46 RWIGDSSPKNFTLSLPGTVATA 67 >01_06_1839 - 40245862-40246022,40246872-40246977,40247868-40247949, 40248337-40248437,40248531-40248568,40248624-40248675 Length = 179 Score = 27.5 bits (58), Expect = 5.5 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = -1 Query: 213 PLMRSEQTFSSERTLRDVSVILIRWIGEISAWGFSISFPDTTAAAMLLRYSGRD 52 P++ SE +S E+ R V G++ AWG + FP T A A R S R+ Sbjct: 25 PMLNSELHYSQEKNKRKV--------GDVPAWGKPLKFP-TGAEAETDRVSTRE 69 >02_05_0551 + 29907768-29907909,29907995-29909280 Length = 475 Score = 26.6 bits (56), Expect = 9.6 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 179 SLEKVCSDLINGAKKQKLRVKG--PVRMPTKVLRITTRKTPCGEGSK 313 ++ C+D + G LRV P + VLR+T R PC K Sbjct: 35 AVSSTCADELPGRDWDSLRVSAASPRNGTSAVLRLTHRHGPCAPAGK 81 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,934,260 Number of Sequences: 37544 Number of extensions: 300345 Number of successful extensions: 817 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 816 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 907440304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -