BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_E03 (506 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 24 2.6 AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 pr... 24 3.4 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 5.9 AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 pr... 23 7.9 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 23 7.9 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 24.2 bits (50), Expect = 2.6 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = -3 Query: 288 RILDARLGPRRRGTSPSVSPGISCAPLRTMTRAKTERLASTMQPR 154 RI+DA P + G + APLR++ + +++A++M PR Sbjct: 394 RIVDALFPVHPPVEWPDLGVG-NMAPLRSIGLTELDQIAASMHPR 437 >AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 protein. Length = 159 Score = 23.8 bits (49), Expect = 3.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 7 RAAGIRHEGQAVLPYETGS 63 R G+RH+ A+LP+ GS Sbjct: 118 RFEGLRHDPFALLPFSAGS 136 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.0 bits (47), Expect = 5.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 213 PLRTMTRAKTERLASTMQPR 154 PLR +T + + +AS MQPR Sbjct: 413 PLREVTDLELQIIASGMQPR 432 >AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 protein. Length = 276 Score = 22.6 bits (46), Expect = 7.9 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = -2 Query: 91 QETYTAVSQDSLFHREALLVPRAEFLQ 11 ++ + + Q ++ HRE+ V + +FLQ Sbjct: 37 EQFFLQLCQSTVLHRESYQVVKRDFLQ 63 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 22.6 bits (46), Expect = 7.9 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = +2 Query: 41 CFPMKQGVLTNSRVRLLMSKGHSCYRPRRDG 133 CF + VL +L+ H C P + G Sbjct: 97 CFVSVEAVLDEETKQLVPEYSHGCMSPEQGG 127 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 511,421 Number of Sequences: 2352 Number of extensions: 10246 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -