SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0001_E01
         (550 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8IBK4 Cluster: Putative uncharacterized protein MAL7P1...    35   1.4  

>UniRef50_Q8IBK4 Cluster: Putative uncharacterized protein MAL7P1.134;
            n=2; Plasmodium|Rep: Putative uncharacterized protein
            MAL7P1.134 - Plasmodium falciparum (isolate 3D7)
          Length = 3351

 Score = 34.7 bits (76), Expect = 1.4
 Identities = 21/48 (43%), Positives = 27/48 (56%), Gaps = 4/48 (8%)
 Frame = -3

Query: 158  NIMILFMSKL---NKY*VPICLYITINIVFIDVIY-NYKRNQLRNQII 27
            N++ LF +KL   NKY   IC YI  N   I+  Y +  RNQ+ N II
Sbjct: 2904 NLLYLFKNKLFYENKYFFDICEYILYNPYIIETSYIHILRNQINNNII 2951


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 482,880,291
Number of Sequences: 1657284
Number of extensions: 8937419
Number of successful extensions: 16424
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 15931
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16419
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 35822246242
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -