BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_D13 (409 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 3.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 3.1 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 3.1 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 4.1 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 5.4 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 5.4 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 5.4 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 21 7.1 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 3.1 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = -3 Query: 230 FNFPYLSNSRSRSSFLIPSTSPPTYTRVPPLLM 132 + FPYL +F++P VP LM Sbjct: 43 WRFPYLCYKNGGGAFMVPYFIALALAGVPMFLM 75 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 3.1 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = -3 Query: 230 FNFPYLSNSRSRSSFLIPSTSPPTYTRVPPLLM 132 + FPYL +F++P VP LM Sbjct: 96 WRFPYLCYKNGGGAFMVPYFIALALAGVPMFLM 128 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 3.1 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +1 Query: 112 VNTNHTIMSSGGTRVYVGGLVEGIKKEDLEREFDKYGK 225 V T TI YVG ++ + E +E+D G+ Sbjct: 510 VKTMKTIKKGSFVTQYVGEVITNEEAEKRGKEYDAAGR 547 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 4.1 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -3 Query: 320 FMALHASSASCKFSNSMNAKPGG 252 F+A A+C+FS A+ GG Sbjct: 458 FLATVVEEAACRFSAVAQAQLGG 480 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.0 bits (42), Expect = 5.4 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +1 Query: 226 LNSVWVALNPPGFAF 270 L VW+ + PPG F Sbjct: 641 LTLVWMIIEPPGTRF 655 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.0 bits (42), Expect = 5.4 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 230 FNFPYLSNSRSRSSFLIP 177 + FPYL +FLIP Sbjct: 5 WRFPYLCYKNGGGAFLIP 22 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.0 bits (42), Expect = 5.4 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +1 Query: 226 LNSVWVALNPPGFAF 270 L VW+ + PPG F Sbjct: 731 LTLVWMIIEPPGTRF 745 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 20.6 bits (41), Expect = 7.1 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +1 Query: 187 KEDLEREFDKYGKL 228 +++ +R F+KYG+L Sbjct: 182 EQEAKRRFEKYGQL 195 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,027 Number of Sequences: 438 Number of extensions: 1848 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10256061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -