BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_D09 (410 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g21430.1 68416.m02704 expressed protein 28 2.1 At4g25780.1 68417.m03710 pathogenesis-related protein, putative ... 27 6.5 >At3g21430.1 68416.m02704 expressed protein Length = 961 Score = 28.3 bits (60), Expect = 2.1 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = -2 Query: 175 LTKSLICLHDKFSRDLY-GRVHTYDHCQ 95 +++ +ICLH K SR+++ G V T DHC+ Sbjct: 528 VSQRVICLHPK-SREIHDGNVLTVDHCR 554 >At4g25780.1 68417.m03710 pathogenesis-related protein, putative similar to gene PR-1 protein - Medicago truncatula, SP|Q40374; contains Pfam profile PF00188: SCP-like extracellular protein Length = 190 Score = 26.6 bits (56), Expect = 6.5 Identities = 10/41 (24%), Positives = 17/41 (41%) Frame = +3 Query: 252 MVWDEELXXXXXXXXXQNKNFHNPDKTLGSGRFQTGETLYW 374 ++WD L Q + ++ +G F GE +YW Sbjct: 71 LIWDRRLQNYAQGWANQRRGDCALRHSVSNGEFNLGENIYW 111 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,237,068 Number of Sequences: 28952 Number of extensions: 184246 Number of successful extensions: 391 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 391 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 615542944 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -