BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_D08 (334 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 2.6 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 3.4 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 20 7.8 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 20 7.8 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.4 bits (43), Expect = 2.6 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +1 Query: 172 PSENEVMESDQVIFLD 219 PS NE++ S+ ++FLD Sbjct: 141 PSTNELVFSEVLLFLD 156 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.0 bits (42), Expect = 3.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 161 SFTPSIFFNRANSFTAY 111 SF P +FF A F AY Sbjct: 3 SFKPLLFFAVATLFAAY 19 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 19.8 bits (39), Expect = 7.8 Identities = 5/13 (38%), Positives = 9/13 (69%) Frame = -2 Query: 51 CDSQIKIFMRRAF 13 CD+ +F+R+ F Sbjct: 163 CDNNFNVFLRQVF 175 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 19.8 bits (39), Expect = 7.8 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = +2 Query: 167 TNHQRMRLWNRIKLYSWTLEP*RRGKRNRSPLKRKTKT 280 TN +W+ + S+TLE R + P+ T + Sbjct: 211 TNSANSSIWSPASIDSFTLEQHRSWCSSSQPVLSTTNS 248 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.313 0.128 0.357 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,736 Number of Sequences: 336 Number of extensions: 1099 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 6473381 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.2 bits)
- SilkBase 1999-2023 -