BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_D08 (334 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT023677-1|AAY85077.1| 146|Drosophila melanogaster IP04417p pro... 37 0.007 AE014296-842|AAF47896.1| 146|Drosophila melanogaster CG15019-PA... 37 0.007 >BT023677-1|AAY85077.1| 146|Drosophila melanogaster IP04417p protein. Length = 146 Score = 36.7 bits (81), Expect = 0.007 Identities = 22/49 (44%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Frame = +1 Query: 52 MAKSLRSRWKR-KCRAIKRERYAVKELARLKKMLGVKDENKPSENEVME 195 M ++ RSR +R + IK+ RY KEL RLKK LG+ D + NE+M+ Sbjct: 1 MGRNNRSRKRRDEMNKIKKARYEAKELIRLKKTLGLLDAD---GNEIMK 46 >AE014296-842|AAF47896.1| 146|Drosophila melanogaster CG15019-PA protein. Length = 146 Score = 36.7 bits (81), Expect = 0.007 Identities = 22/49 (44%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Frame = +1 Query: 52 MAKSLRSRWKR-KCRAIKRERYAVKELARLKKMLGVKDENKPSENEVME 195 M ++ RSR +R + IK+ RY KEL RLKK LG+ D + NE+M+ Sbjct: 1 MGRNNRSRKRRDEMNKIKKARYEAKELIRLKKTLGLLDAD---GNEIMK 46 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.313 0.128 0.357 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,632,639 Number of Sequences: 53049 Number of extensions: 187414 Number of successful extensions: 615 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 615 length of database: 24,988,368 effective HSP length: 75 effective length of database: 21,009,693 effective search space used: 735339255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -