BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_D08 (334 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 22 2.2 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 22 2.2 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 5.2 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 20 6.8 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 20 6.8 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.8 bits (44), Expect = 2.2 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 331 CPFHCSLPLSHRQNSSPRLRLPFQRAAVSFSPS 233 CP HC L Q SSP+ + + + S SPS Sbjct: 347 CPLHCKPELGQSQ-SSPKF-VARREESNSSSPS 377 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.8 bits (44), Expect = 2.2 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -2 Query: 216 QEYNLIRFHNLI 181 Q YN++RF NL+ Sbjct: 386 QIYNMVRFRNLV 397 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 20.6 bits (41), Expect = 5.2 Identities = 9/53 (16%), Positives = 25/53 (47%) Frame = +1 Query: 4 TRSKSTSHKYFNLRITMAKSLRSRWKRKCRAIKRERYAVKELARLKKMLGVKD 162 TR+ + H + ++ + ++ +W + Y +K L+++LG ++ Sbjct: 258 TRTIPSDH--YQVKAMVEIVMKMKWSYVSIIYEESNYGIKAFEELEELLGKRN 308 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 20.2 bits (40), Expect = 6.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 68 EADGSENVELSNEN 109 EA+G+ VEL +EN Sbjct: 246 EAEGAITVELQSEN 259 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 20.2 bits (40), Expect = 6.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 68 EADGSENVELSNEN 109 EA+G+ VEL +EN Sbjct: 336 EAEGAITVELQSEN 349 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.313 0.128 0.357 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,644 Number of Sequences: 438 Number of extensions: 1121 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7466580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.6 bits)
- SilkBase 1999-2023 -