BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_D05 (520 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 23 8.1 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 23 8.1 AY659929-1|AAT51797.1| 140|Anopheles gambiae lysozyme c-2 protein. 23 8.1 >DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain protein protein. Length = 103 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/24 (37%), Positives = 9/24 (37%) Frame = +1 Query: 118 FDYLRSDGCKEPRDCTHRSNITTC 189 F L SD C E R C C Sbjct: 24 FSLLSSDPCLEKRTCRKNEEFVCC 47 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 22.6 bits (46), Expect = 8.1 Identities = 13/38 (34%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -1 Query: 148 PYTRRYGGNQTGQ*CRRASQSRIPEIRY-PEQPEHGAV 38 PYTRR GG Q R++ + Y P H V Sbjct: 182 PYTRRSGGQQRSAGWRQSRSDELDFSMYGPSYHRHQLV 219 >AY659929-1|AAT51797.1| 140|Anopheles gambiae lysozyme c-2 protein. Length = 140 Score = 22.6 bits (46), Expect = 8.1 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -3 Query: 365 HCRRRLLPSLRVC 327 HCR + LP +R C Sbjct: 127 HCRGKALPDIREC 139 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 562,065 Number of Sequences: 2352 Number of extensions: 11000 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47360208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -