BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_D03 (451 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 110 6e-25 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 71 3e-13 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 60 6e-10 SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) 56 1e-08 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 53 1e-07 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 53 1e-07 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 51 4e-07 SB_52029| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 51 4e-07 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 51 4e-07 SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) 51 5e-07 SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) 49 2e-06 SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) 49 2e-06 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 49 2e-06 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) 48 5e-06 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 47 6e-06 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 8e-06 SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) 46 1e-05 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-05 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-05 SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-05 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 43 1e-04 SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_52333| Best HMM Match : RRM_1 (HMM E-Value=2.3e-16) 42 2e-04 SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) 41 4e-04 SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13) 40 7e-04 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 39 0.002 SB_19711| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) 37 0.007 SB_21838| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.012 SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) 35 0.027 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 35 0.027 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 34 0.047 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 34 0.062 SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.062 SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) 33 0.082 SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.082 SB_35697| Best HMM Match : RRM_1 (HMM E-Value=1.3e-19) 33 0.11 SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.19 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.19 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.19 SB_34561| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 31 0.33 SB_43406| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.33 SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) 31 0.33 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_13046| Best HMM Match : La (HMM E-Value=5e-23) 31 0.58 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.77 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_27828| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_24012| Best HMM Match : RRM_1 (HMM E-Value=0.69) 29 1.3 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 29 1.8 SB_56343| Best HMM Match : RRM_1 (HMM E-Value=3.2e-14) 29 1.8 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_30685| Best HMM Match : RRM_1 (HMM E-Value=2e-07) 29 2.3 SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) 29 2.3 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) 28 3.1 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_31130| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_2526| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) 28 4.1 SB_28579| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 28 4.1 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 28 4.1 SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 27 5.4 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) 27 7.2 SB_37866| Best HMM Match : CDC37 (HMM E-Value=0.81) 27 7.2 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 27 7.2 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 27 7.2 SB_8368| Best HMM Match : VWA (HMM E-Value=0) 27 7.2 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 27 7.2 SB_13434| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.52) 27 7.2 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_9365| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_57033| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_41292| Best HMM Match : RRM_1 (HMM E-Value=0.0085) 27 9.5 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 110 bits (264), Expect = 6e-25 Identities = 53/128 (41%), Positives = 88/128 (68%), Gaps = 3/128 (2%) Frame = +3 Query: 75 VGNVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQD-ETGASKGYGFVHFET--EEAANK 245 + ++++ +L + +Y+ FS G++LS +V +D T S GY +V+F+ +AA + Sbjct: 12 IASLYVGDLAPDVTEAMLYEKFSTAGSVLSIRVCRDLVTRRSLGYAYVNFQQPGHDAALE 71 Query: 246 SIEKVNGMLLNGKKVYVGRFIPRKEREKELGEKAKLFTNVYVKNFGEDFSDEMLKDMFEK 425 +I +V+GMLLN KKV+VGR++ +KER +++G + K FTNVYVKNFG+D DE +K++ + Sbjct: 72 AIARVDGMLLNDKKVFVGRWMSKKERIEKMGTQPKKFTNVYVKNFGDDMDDEQMKEICAE 131 Query: 426 YGRITSHK 449 G+I S K Sbjct: 132 AGKIVSLK 139 Score = 93.1 bits (221), Expect = 1e-19 Identities = 53/154 (34%), Positives = 81/154 (52%), Gaps = 15/154 (9%) Frame = +3 Query: 33 GMWSQRDPSLRKSGVG-----NVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGAS 197 G W + + K G NV++KN +D++ M + + G I+S KV D G S Sbjct: 89 GRWMSKKERIEKMGTQPKKFTNVYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTDPEGKS 148 Query: 198 KGYGFVHFETEEAANKSIEKVNGMLLNGKKVYVGRFIPRKER--------EKELGEKAKL 353 KG+GFV FET E A +++ +NG + G++++ GR R ER EK+ E+ Sbjct: 149 KGFGFVSFETPEEAEEAVNVLNGKEIGGRRLWAGRAKKRAERAAEVKAEIEKKRQERINR 208 Query: 354 F--TNVYVKNFGEDFSDEMLKDMFEKYGRITSHK 449 F N+Y+KN + DE L++ F YG I+S K Sbjct: 209 FQGVNLYIKNLDDPIDDERLREEFSPYGTISSAK 242 Score = 79.8 bits (188), Expect = 1e-15 Identities = 40/91 (43%), Positives = 60/91 (65%) Frame = +3 Query: 63 RKSGVGNVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAAN 242 R GV N++IKNLD ID++ + + FS +G I S KV +D+ G SKG+GFV F + E A Sbjct: 208 RFQGV-NLYIKNLDDPIDDERLREEFSPYGTISSAKVMKDDKGNSKGFGFVCFSSPEEAT 266 Query: 243 KSIEKVNGMLLNGKKVYVGRFIPRKEREKEL 335 K++ ++NG +L K +YV R+ER+ +L Sbjct: 267 KAVTEMNGRILISKPLYVALAQRREERKAQL 297 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 71.3 bits (167), Expect = 3e-13 Identities = 36/92 (39%), Positives = 58/92 (63%), Gaps = 2/92 (2%) Frame = +3 Query: 81 NVFIKNLDKTIDNKAMYDTFSAFGNILSC-KVAQD-ETGASKGYGFVHFETEEAANKSIE 254 N+FI NLD +D K +YDTFSAFG IL K+ +D +TG SKG+ F++F + +A++ +IE Sbjct: 101 NLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIE 160 Query: 255 KVNGMLLNGKKVYVGRFIPRKEREKELGEKAK 350 +NG L + + V ++ + + G A+ Sbjct: 161 AMNGQYLCNRPITVSYAFKKESKGERHGSAAE 192 Score = 48.8 bits (111), Expect = 2e-06 Identities = 31/129 (24%), Positives = 63/129 (48%), Gaps = 1/129 (0%) Frame = +3 Query: 54 PSLRKSGVGNVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDE-TGASKGYGFVHFETE 230 P ++ +++ LD+ + +++ F G +++ + +D T +GYGFV F E Sbjct: 5 PIAERNQDATIYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGE 64 Query: 231 EAANKSIEKVNGMLLNGKKVYVGRFIPRKEREKELGEKAKLFTNVYVKNFGEDFSDEMLK 410 E A+ +I+ +N + + GK + V + K L A N+++ N + +++L Sbjct: 65 EDADYAIKVMNMIKVYGKPIRVNK---ASAHNKNLDVGA----NLFIGNLDTEVDEKLLY 117 Query: 411 DMFEKYGRI 437 D F +G I Sbjct: 118 DTFSAFGVI 126 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 63.7 bits (148), Expect = 7e-11 Identities = 34/124 (27%), Positives = 63/124 (50%), Gaps = 1/124 (0%) Frame = +3 Query: 81 NVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDE-TGASKGYGFVHFETEEAANKSIEK 257 N+ I + ++ + + F GN+ SCK+ +D TG S GY FV+++ + ANK++ + Sbjct: 28 NLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVRE 87 Query: 258 VNGMLLNGKKVYVGRFIPRKEREKELGEKAKLFTNVYVKNFGEDFSDEMLKDMFEKYGRI 437 +NG L K + V P K N+Y+ +D +E ++ +F+ +G+I Sbjct: 88 MNGARLQNKTLKVSFARPSSTEIKN--------ANLYISGLPKDMKEEEVEALFKPFGKI 139 Query: 438 TSHK 449 + K Sbjct: 140 ITSK 143 Score = 48.4 bits (110), Expect = 3e-06 Identities = 25/79 (31%), Positives = 40/79 (50%) Frame = +3 Query: 54 PSLRKSGVGNVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEE 233 PS + N++I L K + + + F FG I++ KV +D +G +G GFV F+ Sbjct: 105 PSSTEIKNANLYISGLPKDMKEEEVEALFKPFGKIITSKVLKDVSGEGRGTGFVRFDKRC 164 Query: 234 AANKSIEKVNGMLLNGKKV 290 A +I+ +N L G V Sbjct: 165 EAQTAIDDLNNKTLPGTNV 183 Score = 32.7 bits (71), Expect = 0.14 Identities = 21/67 (31%), Positives = 33/67 (49%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKVN 263 +F+ L + +Y FS +G I + ++ D KGYGFV+ E A +I +N Sbjct: 274 IFVYGLPQEATPLFLYKLFSPYGAITNIELKLD-----KGYGFVNMSNYEEACHAICCLN 328 Query: 264 GMLLNGK 284 G +GK Sbjct: 329 GTPQHGK 335 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 60.5 bits (140), Expect = 6e-10 Identities = 31/122 (25%), Positives = 68/122 (55%), Gaps = 4/122 (3%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGAS-KGYGFVHFETEEAANKSIEKV 260 V++ +++ + + + F FG I ++ D KG+ FV ++ EAA ++E++ Sbjct: 104 VYVGSINFELREEHIRTAFHPFGPINKIDLSWDPLNMKHKGFAFVEYDLPEAAQLALEQM 163 Query: 261 NGMLLNGKKVYVGR--FIPR-KEREKELGEKAKLFTNVYVKNFGEDFSDEMLKDMFEKYG 431 NG+LL G+ + VGR +P+ ++ ++AK + +Y+ + D ++ +K +FE +G Sbjct: 164 NGVLLGGRNIKVGRPSNVPQAAPLIEQFEQEAKKYARIYIASVHPDLLEDDIKSVFEAFG 223 Query: 432 RI 437 ++ Sbjct: 224 KV 225 Score = 52.4 bits (120), Expect = 2e-07 Identities = 24/76 (31%), Positives = 45/76 (59%), Gaps = 1/76 (1%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDE-TGASKGYGFVHFETEEAANKSIEKV 260 ++I ++ + + F AFG ++ C ++++ TG KGYGF+ +E +++AN +I + Sbjct: 201 IYIASVHPDLLEDDIKSVFEAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSANDAIASM 260 Query: 261 NGMLLNGKKVYVGRFI 308 N L G+ + VGR I Sbjct: 261 NLFDLGGQFLRVGRAI 276 >SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) Length = 419 Score = 56.0 bits (129), Expect = 1e-08 Identities = 41/143 (28%), Positives = 71/143 (49%), Gaps = 1/143 (0%) Frame = +3 Query: 18 RNSARGMWSQRDPSLRKSGVGNVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQD-ETGA 194 R+S+ M S D K N++I+ L + + +G I+S K D +T Sbjct: 80 RSSSDRMDSLPDTGEEKLSKTNLYIRGLKANTTDDDLVRLCHKYGTIISTKAILDKDTNL 139 Query: 195 SKGYGFVHFETEEAANKSIEKVNGMLLNGKKVYVGRFIPRKEREKELGEKAKLFTNVYVK 374 KGYGFV FE+ +A K++ L+N K + ++E++ TN+Y++ Sbjct: 140 CKGYGFVDFESPISAQKAV----AALVN--KGIQAQMAKQQEQDP---------TNLYIQ 184 Query: 375 NFGEDFSDEMLKDMFEKYGRITS 443 N ++ + ML++MF KYG++ S Sbjct: 185 NLPQNCDEAMLENMFSKYGKVIS 207 Score = 48.8 bits (111), Expect = 2e-06 Identities = 21/67 (31%), Positives = 38/67 (56%) Frame = +3 Query: 81 NVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKV 260 N++I+NL + D + + FS +G ++S ++ +D+ SKG GF E+ E + I+ Sbjct: 180 NLYIQNLPQNCDEAMLENMFSKYGKVISTRILRDKDTNSKGVGFARMESAEKCEQVIKDF 239 Query: 261 NGMLLNG 281 N +L G Sbjct: 240 NKKMLPG 246 Score = 27.9 bits (59), Expect = 4.1 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +3 Query: 312 RKEREKELGEKAKLFTNVYVKNFGEDFSDEMLKDMFEKYGRITSHK 449 R + + GE+ TN+Y++ + +D+ L + KYG I S K Sbjct: 85 RMDSLPDTGEEKLSKTNLYIRGLKANTTDDDLVRLCHKYGTIISTK 130 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 53.2 bits (122), Expect = 1e-07 Identities = 26/84 (30%), Positives = 46/84 (54%), Gaps = 1/84 (1%) Frame = +3 Query: 81 NVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQD-ETGASKGYGFVHFETEEAANKSIEK 257 +VF+ N+ + + + FS G ++S ++ D ETG KGYGF ++ +E A ++ Sbjct: 26 SVFVGNIPYEASEEQLKEIFSEVGPVISFRLVFDRETGKPKGYGFCEYKDQETALSAMRN 85 Query: 258 VNGMLLNGKKVYVGRFIPRKEREK 329 +NG LNG+ + V K +E+ Sbjct: 86 LNGYELNGRALRVDSAASEKNKEE 109 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 53.2 bits (122), Expect = 1e-07 Identities = 33/134 (24%), Positives = 62/134 (46%), Gaps = 1/134 (0%) Frame = +3 Query: 45 QRDPSLRKSGVGNVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDE-TGASKGYGFVHF 221 Q +P + + + + + + ++ F A ++ +CK+ + + +G S G+GFV + Sbjct: 36 QPEPQEAQESKTTLIVNYIPQDMTDQTFRMMFEAVASLNNCKIVRHKPSGWSYGFGFVDY 95 Query: 222 ETEEAANKSIEKVNGMLLNGKKVYVGRFIPRKEREKELGEKAKLFTNVYVKNFGEDFSDE 401 T E A K+I+K+NG + K + V P + K N+YV N + + Sbjct: 96 NTTEDAQKAIDKLNGFTIGNKVLKVAFSRPGGDNTKG--------ANLYVCNIPKQLPEA 147 Query: 402 MLKDMFEKYGRITS 443 + FE YG I + Sbjct: 148 EFRKAFEAYGNIVN 161 Score = 48.0 bits (109), Expect = 4e-06 Identities = 21/68 (30%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Frame = +3 Query: 81 NVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDE-TGASKGYGFVHFETEEAANKSIEK 257 N+++ N+ K + F A+GNI++C++ +D+ TG KG GFV ++ + A +I Sbjct: 134 NLYVCNIPKQLPEAEFRKAFEAYGNIVNCRLLRDKSTGLPKGCGFVLYDKKAEAQAAISS 193 Query: 258 VNGMLLNG 281 ++G G Sbjct: 194 LSGTFFPG 201 Score = 29.5 bits (63), Expect = 1.3 Identities = 17/83 (20%), Positives = 35/83 (42%), Gaps = 1/83 (1%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQD-ETGASKGYGFVHFETEEAANKSIEKV 260 +++ N+ + + + F G + + D + KG+ FV T+E A +I+ + Sbjct: 277 LYVYNIGYDANQEGITALFGQCGIVNKVDIMWDWQRQQCKGFCFVTMATQEEAQNAIQTL 336 Query: 261 NGMLLNGKKVYVGRFIPRKEREK 329 NG + K + R R + Sbjct: 337 NGFMYTNKPLQSSRIRTLNRRSR 359 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 52.8 bits (121), Expect = 1e-07 Identities = 27/77 (35%), Positives = 43/77 (55%), Gaps = 1/77 (1%) Frame = +3 Query: 72 GVGNVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQD-ETGASKGYGFVHFETEEAANKS 248 G +++ +L I + F FG + S ++ D ET SKGYGFV F EAA ++ Sbjct: 240 GPTRLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRA 299 Query: 249 IEKVNGMLLNGKKVYVG 299 +E++NG L G+ + +G Sbjct: 300 MEQMNGFELAGRPLKIG 316 Score = 39.1 bits (87), Expect = 0.002 Identities = 31/124 (25%), Positives = 55/124 (44%), Gaps = 4/124 (3%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGA-SKGYGFVHFETEEAANKSIEKV 260 VF L + I + + + FS G + ++ D SKG ++ F + A +I + Sbjct: 148 VFCMQLARNIRPRDLEEFFSKVGQVSDVRIISDRNSRRSKGIAYIEFTDKSAVPLAIG-L 206 Query: 261 NGMLLNGKKVYVGRFIPRKEREKELGEKAKLF---TNVYVKNFGEDFSDEMLKDMFEKYG 431 +G L G + V K R E+ K T +YV + + ++ M+K +FE +G Sbjct: 207 SGQKLLGAPIMVMLTQAEKNRLAAEAERLKQPLGPTRLYVGSLHFNITEAMVKAVFEPFG 266 Query: 432 RITS 443 + S Sbjct: 267 TVDS 270 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 51.2 bits (117), Expect = 4e-07 Identities = 27/80 (33%), Positives = 48/80 (60%), Gaps = 1/80 (1%) Frame = +3 Query: 87 FIKNLDKTIDNKAMYDTFSAFGNILSCKVAQD-ETGASKGYGFVHFETEEAANKSIEKVN 263 +I NL ++D +A+ + F +++ KV D ETG +G+GFV F ++E K+I++ + Sbjct: 8 YIGNLSYSVDEQALEEKFHGC-DVVDVKVITDRETGRPRGFGFVTFGSKEEMEKAIDEFD 66 Query: 264 GMLLNGKKVYVGRFIPRKER 323 G +G+ + V + PR ER Sbjct: 67 GQDFDGRPMKVNQAQPRGER 86 >SB_52029| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 462 Score = 51.2 bits (117), Expect = 4e-07 Identities = 25/85 (29%), Positives = 47/85 (55%), Gaps = 3/85 (3%) Frame = +3 Query: 51 DPSLRKSG---VGNVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHF 221 +P ++KS VF+ NLD ++ + + DTF G+++ ++ +D+ SKG G V F Sbjct: 173 NPMMKKSNDPAASTVFVTNLDYKVNWQKLKDTFKCAGHVIRAEIMEDDEKKSKGMGTVQF 232 Query: 222 ETEEAANKSIEKVNGMLLNGKKVYV 296 ET A ++ ++G +L + + V Sbjct: 233 ETPMEAMNAVNLLHGKMLMDRALRV 257 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 51.2 bits (117), Expect = 4e-07 Identities = 33/123 (26%), Positives = 63/123 (51%) Frame = +3 Query: 81 NVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKV 260 +VF+ L D + + D F FG + S ++ + G S+ YGFV F+ + + + ++K Sbjct: 81 SVFVGGLASGTDEEGLKDYFEQFGEVESVRIMRTFLGYSRNYGFVLFKDDGPSKEVLKKS 140 Query: 261 NGMLLNGKKVYVGRFIPRKEREKELGEKAKLFTNVYVKNFGEDFSDEMLKDMFEKYGRIT 440 + ++NGK V VG K++ F +YV F+++ +++ F+K+G I Sbjct: 141 H--VINGKTVDVG--------------KSRNFRVIYVGGLPSHFTEQTVREHFKKFGVIE 184 Query: 441 SHK 449 + K Sbjct: 185 AVK 187 Score = 32.7 bits (71), Expect = 0.14 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 3/71 (4%) Frame = +3 Query: 54 PSLRKSGVGN--VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQD-ETGASKGYGFVHFE 224 P+ K GV +F+ NL + + F +G + + D ETG SKG G V Sbjct: 309 PNEEKQGVRERTLFVDNLSEDTKELDVLRYFRPYGQVAKVHILTDRETGKSKGCGVVKLR 368 Query: 225 TEEAANKSIEK 257 NK +E+ Sbjct: 369 HPGTVNKILEE 379 >SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) Length = 209 Score = 50.8 bits (116), Expect = 5e-07 Identities = 23/72 (31%), Positives = 45/72 (62%), Gaps = 1/72 (1%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDE-TGASKGYGFVHFETEEAANKSIEKV 260 +F+ L+ ++ + FS FG ILSC+V +D+ TG S Y F+ FE +E ++ K+ Sbjct: 122 LFVCKLNPVTTDEDLEIIFSRFGTILSCEVIRDQKTGESLQYAFIEFEKDEDCERAYFKM 181 Query: 261 NGMLLNGKKVYV 296 + +L++ ++++V Sbjct: 182 DNVLIDDRRIHV 193 >SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) Length = 496 Score = 49.2 bits (112), Expect = 2e-06 Identities = 29/118 (24%), Positives = 59/118 (50%), Gaps = 2/118 (1%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKVN 263 +FI L+ + + D FS +G I+ C + + + G S+G+GFV +E+ ++ N+ ++K Sbjct: 52 IFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMKRD-GRSRGFGFVTYESSDSVNEVLKK-K 109 Query: 264 GMLLNGKKVYVGRFIPRKE--REKELGEKAKLFTNVYVKNFGEDFSDEMLKDMFEKYG 431 +L+ +++ R +PR E + + + K+F E+ E + K G Sbjct: 110 DHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYFNSLCRKNG 167 >SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) Length = 362 Score = 49.2 bits (112), Expect = 2e-06 Identities = 24/73 (32%), Positives = 42/73 (57%), Gaps = 1/73 (1%) Frame = +3 Query: 81 NVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQD-ETGASKGYGFVHFETEEAANKSIEK 257 N+FI +L + + + TF FG ++S KV D +T SK +GFV ++ +A +I+ Sbjct: 278 NLFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDNVMSAQNAIQH 337 Query: 258 VNGMLLNGKKVYV 296 +NG + K++ V Sbjct: 338 MNGFQIGAKRLKV 350 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 48.8 bits (111), Expect = 2e-06 Identities = 27/82 (32%), Positives = 50/82 (60%), Gaps = 1/82 (1%) Frame = +3 Query: 81 NVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQD-ETGASKGYGFVHFETEEAANKSIEK 257 +VFI NL I+ + + + F+ GN+ S ++ +D +TG KG+G+V FE+++A ++ K Sbjct: 57 SVFIGNLPFDIEEEPLRELFTTCGNVESVRLIRDRKTGIGKGFGYVLFESKDAVVFAL-K 115 Query: 258 VNGMLLNGKKVYVGRFIPRKER 323 +N G+K+ R P K++ Sbjct: 116 MNNAEFKGRKI---RVFPSKDK 134 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 48.4 bits (110), Expect = 3e-06 Identities = 25/57 (43%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = +3 Query: 156 ILSCKVAQD-ETGASKGYGFVHFETEEAANKSIEKVNGMLLNGKKVYVGRFIPRKER 323 +LS KV D ETG +G+GFV F +E+ +K+I+K +G L+G+ + V + PR ER Sbjct: 35 LLSVKVITDRETGRPRGFGFVTFGSEDEMDKAIDKFDGEDLDGRPMKVNKAQPRGER 91 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 48.0 bits (109), Expect = 4e-06 Identities = 37/123 (30%), Positives = 60/123 (48%), Gaps = 4/123 (3%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDE-TGASKGYGFVHFETEEAANKSIEKV 260 +F+ NL D S +GNI + + E TG SKGYGFV + T E A ++ ++ Sbjct: 115 LFVGNLPFEFTETQFGDLMSPYGNIERLFLVRSEVTGDSKGYGFVEYATRENAMQAKQQ- 173 Query: 261 NGMLLNGKKVYV-GRFIPRKEREKELGEKAKLFT-NVYVKNFGEDFSD-EMLKDMFEKYG 431 LLN Y+ GR + E L A + + ++V DF + ++K++F + G Sbjct: 174 ---LLNTASKYIGGRILRVAFAESNLLTYADVHSRTLFVDRLPRDFKNGGLIKELFSQTG 230 Query: 432 RIT 440 +T Sbjct: 231 NVT 233 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 48.0 bits (109), Expect = 4e-06 Identities = 21/61 (34%), Positives = 35/61 (57%) Frame = +3 Query: 90 IKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKVNGM 269 +KNLD + N+ + FS FG++ V D G SKG+G V F + A+ +++K++ Sbjct: 130 VKNLDNLVTNELLEQAFSQFGDVERAVVVCDVRGRSKGHGIVEFSRKNNAHNAMQKISES 189 Query: 270 L 272 L Sbjct: 190 L 190 >SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) Length = 876 Score = 47.6 bits (108), Expect = 5e-06 Identities = 30/91 (32%), Positives = 52/91 (57%), Gaps = 2/91 (2%) Frame = +3 Query: 84 VFIKNL--DKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEK 257 +FI NL DK I + + + FS G +L C + + +GFV FETE+ A++++ K Sbjct: 48 IFIGNLATDK-IARQDLEEIFSRHGKVLGCSLHAN-------FGFVQFETEKGADEAVAK 99 Query: 258 VNGMLLNGKKVYVGRFIPRKEREKELGEKAK 350 +G ++NGKK+ V R + + +GE+ + Sbjct: 100 EHGRIINGKKIDV-RIVNSRADVNLVGERKR 129 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 47.6 bits (108), Expect = 5e-06 Identities = 34/117 (29%), Positives = 59/117 (50%), Gaps = 4/117 (3%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDE-TGASKGYGFVHFETEEAANKSI-EK 257 +F+ L++ N+ + + F A+G + V D T S+G+G+V F + + +K Sbjct: 16 LFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDK 75 Query: 258 V-NGM-LLNGKKVYVGRFIPRKEREKELGEKAKLFTNVYVKNFGEDFSDEMLKDMFE 422 V NG ++GK+V V R IPR + EK K ++V ED + E +++ E Sbjct: 76 VENGAHRIDGKEVEVKRAIPRDDNSATSHEKTK---KIFVGGLPEDATKEDIQEAIE 129 >SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 268 Score = 47.2 bits (107), Expect = 6e-06 Identities = 21/78 (26%), Positives = 41/78 (52%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKVN 263 +F+K ++ + F +G + K+ +D+ G SKGY F+ FE++E A+ + Sbjct: 10 IFVKGFNRETTESELRAFFEEYGVVKESKIVRDKHGVSKGYAFITFESQEVAD-GLRDNK 68 Query: 264 GMLLNGKKVYVGRFIPRK 317 G+ K + +G+ + RK Sbjct: 69 GLDFKDKVLSIGQAVRRK 86 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 46.8 bits (106), Expect = 8e-06 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 9/94 (9%) Frame = +3 Query: 195 SKGYGFVHFETEEAANKSIEKVNGMLLNGKKVYVGRFIPRKEREKE---------LGEKA 347 SKG+GFV F E A K+I +++ + + GK+V + RK + + + Sbjct: 553 SKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKT-NWAARKNNPTQTKPLVWDDVFHQSS 611 Query: 348 KLFTNVYVKNFGEDFSDEMLKDMFEKYGRITSHK 449 +L T VYV N D D L+ MF +YG I K Sbjct: 612 QLNTTVYVGNLPPDVKDYELQQMFSQYGSILETK 645 Score = 39.9 bits (89), Expect = 0.001 Identities = 28/122 (22%), Positives = 59/122 (48%), Gaps = 1/122 (0%) Frame = +3 Query: 81 NVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKG-YGFVHFETEEAANKSIEK 257 ++++ NLD + + F+ ++ CK+ T KG Y FV FET A ++ + Sbjct: 370 SLYVGNLDPKCTQELICSIFNKIAKVVRCKMINSPT--DKGPYCFVEFETHADAQEAKFR 427 Query: 258 VNGMLLNGKKVYVGRFIPRKEREKELGEKAKLFTNVYVKNFGEDFSDEMLKDMFEKYGRI 437 ++ + KK+ V ++ G+ F +++V + E+ + +L+ FE +G I Sbjct: 428 MDQRTVMDKKLKVNWATNHPGMKR--GDTNNHF-HIFVGDLAENVDNALLRKTFEPFGEI 484 Query: 438 TS 443 ++ Sbjct: 485 SA 486 Score = 30.3 bits (65), Expect = 0.77 Identities = 12/43 (27%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +3 Query: 39 WSQRDPSLRKSGVGN---VFIKNLDKTIDNKAMYDTFSAFGNI 158 W+ P +++ N +F+ +L + +DN + TF FG I Sbjct: 442 WATNHPGMKRGDTNNHFHIFVGDLAENVDNALLRKTFEPFGEI 484 >SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 1026 Score = 46.4 bits (105), Expect = 1e-05 Identities = 40/126 (31%), Positives = 59/126 (46%), Gaps = 12/126 (9%) Frame = +3 Query: 42 SQRD-PSLRKSGVGNVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDE-TGASKGYGFV 215 SQR PS K G+ VFI+NL K + + F FG+I CKV D T SKG FV Sbjct: 404 SQRSKPSDVKEGL-TVFIRNLSFDSTQKNITNLFKQFGDIAYCKVVVDHLTQHSKGSAFV 462 Query: 216 HFETEEAANKSI----EKVNGMLLNGKKVYV------GRFIPRKEREKELGEKAKLFTNV 365 + + E+ + + E G+ L+G ++ V G+ ++KE K N+ Sbjct: 463 KYRSAESVTQCLAATDEDSEGLFLDGNRLQVDLAVTPGKLEQMSRQQKEERRDPKDKRNL 522 Query: 366 YVKNFG 383 Y+ G Sbjct: 523 YLAREG 528 Score = 45.6 bits (103), Expect = 2e-05 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 3/104 (2%) Frame = +3 Query: 48 RDPSLRKSGVGNVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASK---GYGFVH 218 + S + S + I+NL + +TFSAFG + V Q + G G+GFV Sbjct: 237 KSSSPKGSKKSRLIIRNLAFNCTEAILKETFSAFGEVSEASVPQKKVGRRNRKMGFGFVQ 296 Query: 219 FETEEAANKSIEKVNGMLLNGKKVYVGRFIPRKEREKELGEKAK 350 F A K++E++N + G+ V V +P K E EK K Sbjct: 297 FTNVFDAAKALEEMNAKKILGRPVAVDWAVP-KSMYTENQEKHK 339 Score = 32.7 bits (71), Expect = 0.14 Identities = 20/84 (23%), Positives = 41/84 (48%), Gaps = 2/84 (2%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGAS--KGYGFVHFETEEAANKSIEK 257 +F++NL I + F G + + +D+ + +G+G+V F EE A K+ + Sbjct: 22 IFVRNLPYNITDAEFKSAFEEIGPLKRGFIVKDKDNQNRCRGFGYVTFALEEDALKAKDN 81 Query: 258 VNGMLLNGKKVYVGRFIPRKEREK 329 + + G+ +++ F +K R K Sbjct: 82 IKS--IKGRPIHLD-FSEKKARTK 102 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 44.0 bits (99), Expect = 6e-05 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 1/123 (0%) Frame = +3 Query: 75 VGNVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQD-ETGASKGYGFVHFETEEAANKSI 251 VG++ + L M + F+ FG I C+V D T S+G+GFV F+ +E A + Sbjct: 114 VGDLIVLGLPYATTESEMKEYFTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNVL 173 Query: 252 EKVNGMLLNGKKVYVGRFIPRKEREKELGEKAKLFTNVYVKNFGEDFSDEMLKDMFEKYG 431 + G+ V +PR + E + +K ++V E +++ L + F ++G Sbjct: 174 S--TSHRIQGRLCEVR--LPRPKEELNVPKK------LFVGRLPESTTEKTLMEYFAQFG 223 Query: 432 RIT 440 +T Sbjct: 224 EVT 226 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 44.0 bits (99), Expect = 6e-05 Identities = 29/124 (23%), Positives = 66/124 (53%), Gaps = 6/124 (4%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKV---AQDETGASKGYGFVHFETEEAANKSIE 254 +F+ ++ KT + + + FS N L + + D+ G ++G+ F+ +E+ +AA+ + Sbjct: 235 LFVGSIPKTKSKQEILEEFSKVTNGLDDVIVYLSADQKGKNRGFAFLEYESHQAASLARR 294 Query: 255 KV-NGMLL--NGKKVYVGRFIPRKEREKELGEKAKLFTNVYVKNFGEDFSDEMLKDMFEK 425 ++ +G + V V P++E + + +K K+ VY++N ++E LK+ + + Sbjct: 295 RLASGRIKVWGNIVVTVDWADPQEEPDDDAMKKVKV---VYLRNLSPSITEEKLKEEYSQ 351 Query: 426 YGRI 437 YG + Sbjct: 352 YGAV 355 Score = 40.7 bits (91), Expect = 5e-04 Identities = 26/98 (26%), Positives = 51/98 (52%), Gaps = 1/98 (1%) Frame = +3 Query: 51 DPSLRKSGVGNVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETE 230 D +++K V V+++NL +I + + + +S +G A D K Y FVHF Sbjct: 322 DDAMKKVKV--VYLRNLSPSITEEKLKEEYSQYG-------AVDRVKKLKDYAFVHFTER 372 Query: 231 EAANKSIEKVNGMLLNGKKVYVGRFIPRK-EREKELGE 341 + A K+IE+ +G ++G K+ P+ ++++ G+ Sbjct: 373 DHALKAIEETDGKEMDGLKIEASLAKPQPGNKDRQRGQ 410 >SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 44.0 bits (99), Expect = 6e-05 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 1/72 (1%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDE-TGASKGYGFVHFETEEAANKSIEKV 260 +F+ N+ + +++ FS +G I + V D TG KGY V +ET + A ++E + Sbjct: 295 LFVTNIHEEAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEAL 354 Query: 261 NGMLLNGKKVYV 296 NG + G+ + V Sbjct: 355 NGAEMLGQNISV 366 >SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) Length = 2386 Score = 43.2 bits (97), Expect = 1e-04 Identities = 21/69 (30%), Positives = 37/69 (53%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKVN 263 V+I L + + + + F+ FG + + +DE+G S+ GFVHF + + A + +N Sbjct: 526 VWIGGLSEDVTENVLLELFNKFGPVKDVVILRDESGKSRQSGFVHFWSSDVAEAANVGMN 585 Query: 264 GMLLNGKKV 290 G + GK V Sbjct: 586 GCDILGKIV 594 >SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 43.2 bits (97), Expect = 1e-04 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 1/74 (1%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDE-TGASKGYGFVHFETEEAANKSIEKV 260 +FI L ++ + + S+FG + + + +D TG SKGY F + + +I+ + Sbjct: 675 IFIGGLPNYLNEDQVKELLSSFGELRAFNLVKDSATGLSKGYAFCEYVDLGITDVAIQGL 734 Query: 261 NGMLLNGKKVYVGR 302 NGM L KK+ V R Sbjct: 735 NGMQLGDKKLIVQR 748 >SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 347 Score = 42.7 bits (96), Expect = 1e-04 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +3 Query: 126 MYDTFSAFGNILSCKVAQD-ETGASKGYGFVHFETEEAANKSIEKVNGMLLNGKKVYV 296 + TF FG ++S KV D +T SK +GFV ++ +A +I+ +NG + K++ V Sbjct: 278 LMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKV 335 Score = 31.5 bits (68), Expect = 0.33 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 81 NVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQD-ETGASKGYG 209 N+FI +L + + + TF FG ++S KV D +T SK +G Sbjct: 230 NLFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFG 273 >SB_52333| Best HMM Match : RRM_1 (HMM E-Value=2.3e-16) Length = 76 Score = 41.9 bits (94), Expect = 2e-04 Identities = 22/83 (26%), Positives = 44/83 (53%) Frame = +3 Query: 75 VGNVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIE 254 V +++++N+ + + F+ +G I + +D YGFV+F E+A ++I+ Sbjct: 1 VKSIYVRNVPLPMSETQLKAVFTKYGQIEKVRKIRD-------YGFVYFAKRESAVQAID 53 Query: 255 KVNGMLLNGKKVYVGRFIPRKER 323 +NG ++G K+ V IP+ R Sbjct: 54 GINGAYIDGCKLEVSLAIPQSSR 76 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 360 NVYVKNFGEDFSDEMLKDMFEKYGRI 437 ++YV+N S+ LK +F KYG+I Sbjct: 3 SIYVRNVPLPMSETQLKAVFTKYGQI 28 >SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) Length = 145 Score = 41.1 bits (92), Expect = 4e-04 Identities = 19/78 (24%), Positives = 42/78 (53%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKVN 263 ++I++ I ++ F +G I + + +TG SKG+G+V +E E+A +++ + Sbjct: 65 IYIRDFRPDIRKSSLESVFGPYGAIEDLSIIRTQTGKSKGFGYVTYENAESAQRALAGTH 124 Query: 264 GMLLNGKKVYVGRFIPRK 317 +++GK V +P + Sbjct: 125 --IIDGKWVIAEPKMPTR 140 >SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13) Length = 260 Score = 40.3 bits (90), Expect = 7e-04 Identities = 17/33 (51%), Positives = 25/33 (75%) Frame = +3 Query: 198 KGYGFVHFETEEAANKSIEKVNGMLLNGKKVYV 296 +G+GFV F T ANK+ EK+NG +++G+KV V Sbjct: 124 EGFGFVTFNTAAEANKAREKLNGTIVDGRKVEV 156 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 39.9 bits (89), Expect = 0.001 Identities = 22/72 (30%), Positives = 40/72 (55%) Frame = +3 Query: 81 NVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKV 260 +VF+ NL D + + F G +C+V E G S+G+G+ F ++E NK++E + Sbjct: 181 SVFLGNLSFDADEETLAAFFEEKGLSATCRVITQE-GRSRGFGYADFTSKEDYNKALE-L 238 Query: 261 NGMLLNGKKVYV 296 NG G+++ + Sbjct: 239 NGEDCCGREIRI 250 Score = 39.5 bits (88), Expect = 0.001 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Frame = +3 Query: 141 SAFGNILSCKVAQD-ETGASKGYGFVHFETEEAANKSIEKVNGMLLNGKKVYVGRFIPRK 317 +AF + KV D E+G S+G+GFV ++ E A K + ++ G ++G++V + PR Sbjct: 307 AAFEGCSNAKVIFDRESGESRGFGFVDYDDVETAKKVLSEMAGAEVDGRQVRLDFASPRT 366 Query: 318 E 320 E Sbjct: 367 E 367 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 39.9 bits (89), Expect = 0.001 Identities = 23/90 (25%), Positives = 45/90 (50%), Gaps = 1/90 (1%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQD-ETGASKGYGFVHFETEEAANKSIEKV 260 ++I NL+ D + F FG + + +D E+G S+G+GFV ++ + +IEK+ Sbjct: 11 LYIGNLNFNSDEGEIEQAFEEFG-VEKVDILRDKESGRSRGFGFVLLQSADQIAPAIEKM 69 Query: 261 NGMLLNGKKVYVGRFIPRKEREKELGEKAK 350 N + G+ + V + + E G + + Sbjct: 70 NQSSVGGRNITVALALDKTENRGGGGRRER 99 >SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 39.9 bits (89), Expect = 0.001 Identities = 19/80 (23%), Positives = 38/80 (47%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKVN 263 +F+ NL + + FS G + ++ + G KGYG+V +E E +A+ ++ ++ Sbjct: 173 LFVSNLPFDAKESEIEELFSKHGVVKQVRLVTNRAGKPKGYGYVEYEQESSASTAVLTLD 232 Query: 264 GMLLNGKKVYVGRFIPRKER 323 + G+ + V P R Sbjct: 233 KTEVKGRTISVALSNPPTRR 252 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/48 (35%), Positives = 29/48 (60%) Frame = +3 Query: 171 VAQDETGASKGYGFVHFETEEAANKSIEKVNGMLLNGKKVYVGRFIPR 314 + ETG +G+GFV F ++E K+I++ +G L+G+ + V PR Sbjct: 128 ITDRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDLDGRPMKVNEAKPR 175 >SB_19711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 81 NVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHF 221 ++ I+NL K I K + + +GN+L C + +D G S G V F Sbjct: 120 DLIIQNLPKGIQEKDLKELLQLYGNVLVCNIERDSNGDSSGSALVRF 166 >SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) Length = 672 Score = 37.1 bits (82), Expect = 0.007 Identities = 19/89 (21%), Positives = 45/89 (50%), Gaps = 1/89 (1%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDE-TGASKGYGFVHFETEEAANKSIEKV 260 +F +L + ++++ F+ + + L K+ +D+ + SKGYGFV F+ K++ ++ Sbjct: 219 IFCGDLGSEVTDESLTRAFAKYTSFLKAKIVRDKKSNKSKGYGFVSFKDPNDFIKAMREM 278 Query: 261 NGMLLNGKKVYVGRFIPRKEREKELGEKA 347 N + + + P+ E ++ +A Sbjct: 279 NVLSFADQHLLTPFIYPKSWPENDIYRQA 307 >SB_21838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 36.3 bits (80), Expect = 0.012 Identities = 18/79 (22%), Positives = 45/79 (56%), Gaps = 2/79 (2%) Frame = +3 Query: 102 DKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKVNG--MLL 275 D+ ++ + + ++A ++ +++ G ++G+GFV F+T EAA + ++ + G + + Sbjct: 340 DEISEDDVLQELYAAEVAFRDVRIVRNKIGYTRGFGFVEFDTPEAAKEWMDYLKGGPLKV 399 Query: 276 NGKKVYVGRFIPRKEREKE 332 G + V P++ +EK+ Sbjct: 400 LGYNIGVEYSRPKEGQEKD 418 >SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) Length = 665 Score = 35.1 bits (77), Expect = 0.027 Identities = 20/61 (32%), Positives = 33/61 (54%) Frame = +3 Query: 186 TGASKGYGFVHFETEEAANKSIEKVNGMLLNGKKVYVGRFIPRKEREKELGEKAKLFTNV 365 T +G+GFV FE+E +A+K+ + L+N KKV V + P++ G + + V Sbjct: 8 TQRHRGFGFVTFESENSADKACD-TQYHLINNKKVEVKKAQPKEVMYSLQGGRGRAGRGV 66 Query: 366 Y 368 Y Sbjct: 67 Y 67 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 35.1 bits (77), Expect = 0.027 Identities = 18/59 (30%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +3 Query: 87 FIKNLDKTIDNKAMYDTFSAFGNILSCKVAQD-ETGASKGYGFVHFETEEAANKSIEKV 260 +I NL ++D +A+ + F N++ +V D ETG +G+GFV E ++ K ++ + Sbjct: 85 YIGNLSYSVDEQALEEKFHDC-NVVDVRVITDRETGRPRGFGFVTLEAKKTRIKPLKNL 142 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 34.3 bits (75), Expect = 0.047 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDE-TGASKGYGFVHFETEEAANKSIEKV 260 +F+ + + A+ F+ FG I V +D T SKGYGFV T +AA + + Sbjct: 12 LFVGGIPYESGDDALRKFFAQFGEIREAVVIKDRVTKKSKGYGFVTMATSDAAELACKNK 71 Query: 261 NGML 272 M+ Sbjct: 72 RPMI 75 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 33.9 bits (74), Expect = 0.062 Identities = 26/119 (21%), Positives = 52/119 (43%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKVN 263 +F+ N++KT + + F +G ++ + + + Y FV F +A ++ K++ Sbjct: 251 LFVGNIEKTTTYGDLKEAFERYGEVIDVDIKKQP--GNNPYAFVQFAELSSAIQARRKMD 308 Query: 264 GMLLNGKKVYVGRFIPRKEREKELGEKAKLFTNVYVKNFGEDFSDEMLKDMFEKYGRIT 440 + YVGR R K K ++V S++ ++ F +YGR+T Sbjct: 309 -------REYVGR-----NRVKVGFGKVNPINTIWVGGVTNSLSEQQVERHFGRYGRVT 355 >SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 33.9 bits (74), Expect = 0.062 Identities = 14/51 (27%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = +3 Query: 147 FGNILSCKVAQDE-TGASKGYGFVHFETEEAANKSIEKVNGMLLNGKKVYV 296 +G I++ + +D+ TG KG+ F+ +E + + +++ NG+ L G+ + V Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRSTILAVDNFNGIKLGGRTIRV 52 >SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) Length = 929 Score = 33.5 bits (73), Expect = 0.082 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 1/90 (1%) Frame = +3 Query: 30 RGMWSQR-DPSLRKSGVGNVFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGY 206 R MW + P +R + +V ++NL + + D F +G + + G Sbjct: 783 RPMWLDKYGPPVRTNY--SVIVENLSSRTSWQDLKDYFRKYGKVTYADAHKKRIGE---- 836 Query: 207 GFVHFETEEAANKSIEKVNGMLLNGKKVYV 296 G V FE+++ N +IEK++ L G+++ V Sbjct: 837 GVVEFESKDDLNTAIEKLDDTELGGRRIRV 866 Score = 33.1 bits (72), Expect = 0.11 Identities = 31/104 (29%), Positives = 46/104 (44%), Gaps = 23/104 (22%) Frame = +3 Query: 198 KGYGFVHFETEEAANKSIEKVNGMLLNGKKVYV----GR-----------FIPRKERE-- 326 +GYGFV F+ A ++ +NG L G++V V GR F R R+ Sbjct: 722 RGYGFVEFDDHRDAEDAVHDLNGRDLIGERVVVEFSKGRRSEGGGRDRRDFSGRGGRDGG 781 Query: 327 ------KELGEKAKLFTNVYVKNFGEDFSDEMLKDMFEKYGRIT 440 + G + +V V+N S + LKD F KYG++T Sbjct: 782 RRPMWLDKYGPPVRTNYSVIVENLSSRTSWQDLKDYFRKYGKVT 825 >SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 33.5 bits (73), Expect = 0.082 Identities = 18/69 (26%), Positives = 35/69 (50%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKVN 263 VF+ NLD I + + FS+ G+I ++ D+ G Y ++ F +A +++ + Sbjct: 74 VFVNNLDPEITAEMLLSFFSSCGDIKYIRMGGDD-GKPTRYAYIEFAETQAIVSALQ-YS 131 Query: 264 GMLLNGKKV 290 G + GK + Sbjct: 132 GAIFGGKPI 140 >SB_35697| Best HMM Match : RRM_1 (HMM E-Value=1.3e-19) Length = 168 Score = 33.1 bits (72), Expect = 0.11 Identities = 13/60 (21%), Positives = 30/60 (50%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKVN 263 VF+ + + + + F G I ++ D G ++GY FV + +++ A + ++ +N Sbjct: 76 VFVGKIPRDLYEDELVPVFETAGPIYEVRLMMDFNGQNRGYAFVVYTSKDDAKRCVKTLN 135 >SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 781 Score = 32.7 bits (71), Expect = 0.14 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +3 Query: 105 KTIDNKAMYDTFSAFGNILSCKVAQD-ETGASKGYGFVHFETEEAANKSIEKVNGML 272 K +++ + F +FG+I ++ +D +T +KGYG+V F A ++E + L Sbjct: 62 KDFNDEDLRSKFESFGDIEYVQIVRDHKTRENKGYGYVKFHKSSTAAMALENCDKSL 118 >SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 32.3 bits (70), Expect = 0.19 Identities = 17/72 (23%), Positives = 32/72 (44%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKVN 263 +F+ NL+ I + + +F FG +L + + G Y FV F + A K+ + Sbjct: 239 LFVGNLETGISCQDLRLSFEKFGVVLDVDIKRPARGQGNTYAFVKFADLDVAAKAKCAMQ 298 Query: 264 GMLLNGKKVYVG 299 G + + +G Sbjct: 299 GQCIGRNHIKIG 310 >SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 32.3 bits (70), Expect = 0.19 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 48 VGTTCLVPNSCSPGDP 1 VG TC + NSCSPGDP Sbjct: 5 VGFTCALSNSCSPGDP 20 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 32.3 bits (70), Expect = 0.19 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +3 Query: 177 QDETGASKGYGFVHFETEEAANKSIEKVNGMLLNGKKVYVGRFIPR 314 Q + S+G+GFV F E A +++ +NG + G+ + + I R Sbjct: 92 QQQEPRSRGFGFVTFANPEDAQTAVKSLNGKEVQGRTLKIAPSISR 137 >SB_34561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 448 Score = 31.9 bits (69), Expect = 0.25 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +3 Query: 132 DTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKVNGMLLNGKK 287 + FS FG + V D +G S G V F E A +++++ NG+ L+ K Sbjct: 1 ELFSEFGQVKRSCVHYDASGRSHGTAEVVFVRREDAQQALKQYNGVPLDAAK 52 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 31.5 bits (68), Expect = 0.33 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 3 DPPGCRNSARGMWSQRDPSLRKSGVGNVFI 92 DPPGCRNS + D GVG+V I Sbjct: 17 DPPGCRNSISKLCKDLDEIWTDQGVGDVII 46 >SB_43406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 576 Score = 31.5 bits (68), Expect = 0.33 Identities = 12/25 (48%), Positives = 21/25 (84%) Frame = +3 Query: 195 SKGYGFVHFETEEAANKSIEKVNGM 269 ++ GFV F+T EAA+K+I+++NG+ Sbjct: 142 NRSQGFVTFDTWEAADKAIDEMNGL 166 >SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) Length = 171 Score = 31.5 bits (68), Expect = 0.33 Identities = 14/50 (28%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +3 Query: 138 FSAFGNILSCKVAQDETGA-SKGYGFVHFETEEAANKSIEKVNGMLLNGK 284 F FG + ++++ + A SKGY FV F +E A + + ++ ++ G+ Sbjct: 118 FEQFGTVNRIRLSRSKKSARSKGYAFVEFACDEVAKIAADTMHNYMMFGR 167 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.7 bits (66), Expect = 0.58 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 66 CAEKDLVGTTCLVPNSCSPGDP 1 CA+K G + NSCSPGDP Sbjct: 7 CAKKTETGRSACPSNSCSPGDP 28 >SB_13046| Best HMM Match : La (HMM E-Value=5e-23) Length = 442 Score = 30.7 bits (66), Expect = 0.58 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +3 Query: 114 DNKAMYDTFSAFGNILSCKVAQ-DETGASKGYGFVHFETEEAANKSIEKVN 263 D+ + FS FG +L + + G KG+ F+ FE+++ A ++ N Sbjct: 100 DHDWLKKVFSEFGKVLYVSLPRFKHNGEIKGFAFIEFESKQQAEHVVQMFN 150 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 30.3 bits (65), Expect = 0.77 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 54 DLVGTTCLVPNSCSPGDP 1 D+V C V NSCSPGDP Sbjct: 19 DVVPFYCYVSNSCSPGDP 36 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.9 bits (64), Expect = 1.0 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 36 CLVPNSCSPGDP 1 CL+ NSCSPGDP Sbjct: 69 CLISNSCSPGDP 80 >SB_27828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 29.5 bits (63), Expect = 1.3 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 96 NLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASK 200 +L ++IDN +D F F N+L+ K+ DE +K Sbjct: 13 SLGESIDNPGNFDEFFVFKNLLAFKLRVDEAPQTK 47 >SB_24012| Best HMM Match : RRM_1 (HMM E-Value=0.69) Length = 166 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +3 Query: 183 ETGASKGYGFVHFETEEAANKSI 251 ++G SK YGFV F+ EEA K++ Sbjct: 98 KSGRSKKYGFVFFKDEEACEKAM 120 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 1.3 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 3/19 (15%) Frame = -2 Query: 48 VGTTCLVP---NSCSPGDP 1 VG TC +P NSCSPGDP Sbjct: 5 VGFTCALPQKSNSCSPGDP 23 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/18 (66%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -2 Query: 51 LVGTTCLVP-NSCSPGDP 1 + GTT + P NSCSPGDP Sbjct: 175 IAGTTTIPPSNSCSPGDP 192 >SB_56343| Best HMM Match : RRM_1 (HMM E-Value=3.2e-14) Length = 273 Score = 29.1 bits (62), Expect = 1.8 Identities = 23/95 (24%), Positives = 44/95 (46%), Gaps = 4/95 (4%) Frame = +3 Query: 84 VFIKNLDKTIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKVN 263 +F+ NL + + + D F G+ + + +SKG GF+ + K++ ++ Sbjct: 76 LFVGNLPFDLTTEKVLDHFRCAGSSSFRLLTKKTDNSSKGCGFLEIDDSIGYTKAL-NLH 134 Query: 264 GMLLNGKKVYV----GRFIPRKEREKELGEKAKLF 356 L G+K+ V G +R+++L EK K F Sbjct: 135 HSYLGGRKINVEVTCGGGGSSDKRKEKLQEKKKKF 169 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.1 bits (62), Expect = 1.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 66 CAEKDLVGTTCLVPNSCSPGDP 1 C + V C+ NSCSPGDP Sbjct: 8 CENQLFVQGNCMKSNSCSPGDP 29 >SB_30685| Best HMM Match : RRM_1 (HMM E-Value=2e-07) Length = 349 Score = 28.7 bits (61), Expect = 2.3 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = +3 Query: 309 PRKEREKELGEKAKLFTNVYVKNFGEDFSDEMLKDMFEKYGRI 437 P +E E +KAK T VYVK F ++ + + L++ FE G+I Sbjct: 65 PVEELTTEARQKAKAKT-VYVKGFPKEATLDELQEYFEGKGKI 106 >SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) Length = 623 Score = 28.7 bits (61), Expect = 2.3 Identities = 14/51 (27%), Positives = 29/51 (56%) Frame = +3 Query: 180 DETGASKGYGFVHFETEEAANKSIEKVNGMLLNGKKVYVGRFIPRKEREKE 332 + T + G GFV F E A K+ +++G + G+ +++ +P K +++E Sbjct: 276 EHTNKTIGIGFVTFLMPEHAVKAFNELDGTVFQGRLLHI---LPAKAKKEE 323 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 28.3 bits (60), Expect = 3.1 Identities = 14/50 (28%), Positives = 27/50 (54%) Frame = +3 Query: 183 ETGASKGYGFVHFETEEAANKSIEKVNGMLLNGKKVYVGRFIPRKEREKE 332 ET S+ +G+V F E+ A +++++ G GK+++ +EKE Sbjct: 12 ETRRSRNFGYVTFRDEQDAADAMKQMGGESGKGKEIFGRALNIEYAQEKE 61 >SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) Length = 44 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/42 (26%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +3 Query: 147 FGNILSCKVAQDE-TGASKGYGFVHFETEEAANKSIEKVNGM 269 +G I++ + +D+ TG KG+ F+ +E + + +++ NG+ Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRSTILAVDNFNGI 43 >SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 3.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 Query: 39 TCLVPNSCSPGDP 1 TC NSCSPGDP Sbjct: 24 TCFSSNSCSPGDP 36 >SB_31130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 3.1 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 42 TTCLVPNSCSPGDP 1 +TC NSCSPGDP Sbjct: 4 STCEASNSCSPGDP 17 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 3.1 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 36 CLVPNSCSPGDP 1 C V NSCSPGDP Sbjct: 32 CTVSNSCSPGDP 43 >SB_2526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 Query: 75 LQTCAEKDLVGTTCLVPNSCSPGDP 1 L+ +E +L C NSCSPGDP Sbjct: 30 LEAPSEVELYLDICHTSNSCSPGDP 54 >SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) Length = 201 Score = 27.9 bits (59), Expect = 4.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 357 TNVYVKNFGEDFSDEMLKDMFEKYGRIT 440 T +YV N G + L+ FEK+GR++ Sbjct: 4 TKLYVGNLGRNADSSELERAFEKFGRLS 31 >SB_28579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 27.9 bits (59), Expect = 4.1 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = -1 Query: 382 PKFFT*TLVNNLAFSPNSFSRSLRGMNLPTYTFFPFSNIPL 260 P+F L+ L FS LR N+P FSNIPL Sbjct: 8 PRFSNTPLLPLLRFSNTPLLALLRFSNIPLLPLLRFSNIPL 48 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 27.9 bits (59), Expect = 4.1 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 7/74 (9%) Frame = +3 Query: 3 DPPGCRNS-----ARGMWSQRDPSLR--KSGVGNVFIKNLDKTIDNKAMYDTFSAFGNIL 161 DPPGCRNS R + ++ P+L+ +S VG++ I N I+ G+I+ Sbjct: 661 DPPGCRNSISSSNQRKIKEKKAPNLQEVRSLVGSI-IANAFDAIEEDQRKQVKCMVGDIV 719 Query: 162 SCKVAQDETGASKG 203 +A+ E G Sbjct: 720 KAAIAEVEREEDDG 733 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 27.9 bits (59), Expect = 4.1 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 45 GTTCLVPNSCSPGDP 1 G +V NSCSPGDP Sbjct: 73 GVNTIVSNSCSPGDP 87 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 4.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 51 LVGTTCLVPNSCSPGDP 1 L+ ++ NSCSPGDP Sbjct: 8 LISANIIISNSCSPGDP 24 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 27.9 bits (59), Expect = 4.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 363 VYVKNFGEDFSDEMLKDMFEKYGRI 437 VYV N +D ++ L D+F KYG I Sbjct: 263 VYVGNLPQDVREKDLHDIFYKYGHI 287 >SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 4.1 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 51 LVGTTCLVPNSCSPGDP 1 +V C + NSCSPGDP Sbjct: 1 MVNLHCSLSNSCSPGDP 17 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 27.5 bits (58), Expect = 5.4 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 3 DPPGCRNSARGMWSQRDPSLRKSGVGNVF 89 DPPGCRNS R + +L + G ++ Sbjct: 17 DPPGCRNSIRTVAQLLVEALHRRGTRRIY 45 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 5.4 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 51 LVGTTCLVPNSCSPGDP 1 L+ ++ NSCSPGDP Sbjct: 8 LISANIVISNSCSPGDP 24 >SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 5.4 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +2 Query: 2 GSPGLQEFGTRHV 40 GSPGLQEF RHV Sbjct: 16 GSPGLQEFDLRHV 28 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 5.4 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 36 CLVPNSCSPGDP 1 CL NSCSPGDP Sbjct: 13 CLRSNSCSPGDP 24 >SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 51 LVGTTCLVPNSCSPGDP 1 LV T L NSCSPGDP Sbjct: 12 LVPLTILGSNSCSPGDP 28 >SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.5 bits (58), Expect = 5.4 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 57 KDLVGTTCLVPNSCSPGDP 1 K+ +G+ + NSCSPGDP Sbjct: 14 KNTIGSYEVTSNSCSPGDP 32 >SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 5.4 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -2 Query: 39 TCLVPNSCSPGDP 1 +C NSCSPGDP Sbjct: 8 SCFASNSCSPGDP 20 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 60 EKDLVGTTCLVPNSCSPGDP 1 E+ L T +V NSCSPGDP Sbjct: 76 EECLTLTQRIVSNSCSPGDP 95 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 27.1 bits (57), Expect = 7.2 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 4/27 (14%) Frame = -2 Query: 69 TCAEKDLVGTTCLV----PNSCSPGDP 1 T + KD++ +T +V NSCSPGDP Sbjct: 498 TSSYKDIIESTHIVVTFLSNSCSPGDP 524 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.1 bits (57), Expect = 7.2 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -2 Query: 36 CLVPNSCSPGDP 1 C NSCSPGDP Sbjct: 14 CFTSNSCSPGDP 25 >SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) Length = 440 Score = 27.1 bits (57), Expect = 7.2 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +3 Query: 201 GYGFVHFETEEAANKSIEKVNGMLLNGKKVYVGRFIPRKEREK 329 G G V F TEE ++I ++ GK++ + + +PR K Sbjct: 139 GEGVVEFTTEEDMKRAIASLDKCEFYGKRIRLRQELPRSGTSK 181 Score = 26.6 bits (56), Expect = 9.5 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +3 Query: 285 KVYVGRFIPRKEREKELGEKAKLFTNVYVKNFGEDFSDEMLKD 413 KVY GR +P EK+L K+F V +F E ++ + K+ Sbjct: 4 KVYCGR-LPATATEKDLENLVKVFGKVREVDFKEGYAYVVFKE 45 >SB_37866| Best HMM Match : CDC37 (HMM E-Value=0.81) Length = 461 Score = 27.1 bits (57), Expect = 7.2 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +3 Query: 216 HFETEEAANKSIEKVNGMLLNGKKVYVGRFIPRKE--REKELGEKAKLFTNVYVKNF 380 H ET+ K EKVN L+N K + + I K ++K++ + L T V+ F Sbjct: 402 HCETQNKLKKVFEKVNASLMNAAK--LAKVIGNKYGIKQKDVEKITTLHTQSAVEEF 456 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 Query: 39 TCLVPNSCSPGDP 1 T L NSCSPGDP Sbjct: 13 TALTSNSCSPGDP 25 >SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) Length = 126 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 2 GSPGLQEFGTRHVVPTR 52 GSPGLQEF T+ ++ TR Sbjct: 16 GSPGLQEFDTKGLLHTR 32 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 Query: 84 HSQLQTCAEKDLVGTTCLVPNSCSPGDP 1 H L + T V NSCSPGDP Sbjct: 196 HKNLMKIISSPEICKTVNVSNSCSPGDP 223 >SB_8368| Best HMM Match : VWA (HMM E-Value=0) Length = 771 Score = 27.1 bits (57), Expect = 7.2 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +3 Query: 153 NILSCKVAQDETGASKGYGFVHFETEEAANKSIEKVNGMLLNGKKV 290 N ++ K DE +G F+ + +A K + NGM LN KKV Sbjct: 194 NNVNIKRDIDELRLERGLTFIDKALKISAEKLFTEKNGMRLNRKKV 239 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 57 KDLVGTTCLVPNSCSPGDP 1 K L+ +V NSCSPGDP Sbjct: 3466 KALIYVARVVSNSCSPGDP 3484 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 42 TTCLVPNSCSPGDP 1 T L+ NSCSPGDP Sbjct: 3 TAILLSNSCSPGDP 16 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 27.1 bits (57), Expect = 7.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -2 Query: 84 HSQLQTCAEKDLVGTTCLVPNSCSPGDP 1 H +L+ A D +G NSCSPGDP Sbjct: 81 HQELELAA--DALGDAQPPSNSCSPGDP 106 >SB_13434| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.52) Length = 835 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 369 VKNFGEDFSDEMLKDMFEKYGRIT 440 ++ +D D+ LK F KYGRIT Sbjct: 212 LRGIAQDTKDKQLKLTFTKYGRIT 235 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 33 LVPNSCSPGDP 1 LV NSCSPGDP Sbjct: 24 LVSNSCSPGDP 34 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 57 KDLVGTTCLVPNSCSPGDP 1 K++V L NSCSPGDP Sbjct: 17 KNVVWLQLLPSNSCSPGDP 35 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 33 LVPNSCSPGDP 1 LV NSCSPGDP Sbjct: 3 LVSNSCSPGDP 13 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 33 LVPNSCSPGDP 1 LV NSCSPGDP Sbjct: 17 LVSNSCSPGDP 27 >SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 26.6 bits (56), Expect = 9.5 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 36 CLVPNSCSPGDP 1 C + NSCSPGDP Sbjct: 5 CKLSNSCSPGDP 16 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/13 (84%), Positives = 11/13 (84%), Gaps = 1/13 (7%) Frame = -2 Query: 36 CLVP-NSCSPGDP 1 C VP NSCSPGDP Sbjct: 53 CRVPSNSCSPGDP 65 >SB_9365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +3 Query: 138 FSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKVNGMLLNGKKVY 293 FS FG I++ E ++GY F+ F A ++++ NG L+ ++ Sbjct: 98 FSKFGQIVTEHYPM-EKDLTRGYIFLEFSNASDAVRAVKTANGYKLDKHHIF 148 >SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 Query: 54 DLVGTTCLVPNSCSPGDP 1 DL G NSCSPGDP Sbjct: 6 DLKGEAVSSSNSCSPGDP 23 >SB_57033| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 686 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 315 KEREKELGEKAKLFTNVYVKNFGEDF 392 KERE+EL A++ N FGEDF Sbjct: 114 KERERELFFLARITANSECSVFGEDF 139 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 33 LVPNSCSPGDP 1 LV NSCSPGDP Sbjct: 9 LVSNSCSPGDP 19 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 26.6 bits (56), Expect = 9.5 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 36 CLVPNSCSPGDP 1 C + NSCSPGDP Sbjct: 2 CDISNSCSPGDP 13 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 33 LVPNSCSPGDP 1 LV NSCSPGDP Sbjct: 5 LVSNSCSPGDP 15 >SB_41292| Best HMM Match : RRM_1 (HMM E-Value=0.0085) Length = 292 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 204 YGFVHFETEEAANKSIEKVNGMLLNGKKVYVGRFIPRKE 320 Y FV F + +AA ++ E+VNG L + +F RK+ Sbjct: 80 YAFVKFYSAKAALRAKEEVNGKWLIDGNILKVQFASRKK 118 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 33 LVPNSCSPGDP 1 LV NSCSPGDP Sbjct: 2 LVSNSCSPGDP 12 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 26.6 bits (56), Expect = 9.5 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -2 Query: 42 TTCLVPNSCSPGDP 1 T ++ NSCSPGDP Sbjct: 2 TIVIISNSCSPGDP 15 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -2 Query: 75 LQTCAEKDLVGTTC---LVPNSCSPGDP 1 ++ CA L +T + NSCSPGDP Sbjct: 29 IEVCAAAGLTKSTTESTITSNSCSPGDP 56 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 51 LVGTTCLVPNSCSPGDP 1 L+ V NSCSPGDP Sbjct: 8 LISANISVSNSCSPGDP 24 >SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 45 GTTCLVPNSCSPGDP 1 GT+ NSCSPGDP Sbjct: 23 GTSAKESNSCSPGDP 37 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 26.6 bits (56), Expect = 9.5 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 36 CLVPNSCSPGDP 1 C + NSCSPGDP Sbjct: 12 CDISNSCSPGDP 23 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 33 LVPNSCSPGDP 1 LV NSCSPGDP Sbjct: 26 LVSNSCSPGDP 36 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 33 LVPNSCSPGDP 1 LV NSCSPGDP Sbjct: 26 LVSNSCSPGDP 36 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 26.6 bits (56), Expect = 9.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -2 Query: 36 CLVPNSCSPGDP 1 C NSCSPGDP Sbjct: 19 CAASNSCSPGDP 30 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,728,400 Number of Sequences: 59808 Number of extensions: 259622 Number of successful extensions: 2253 Number of sequences better than 10.0: 122 Number of HSP's better than 10.0 without gapping: 2129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2237 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 896151577 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -