BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_D02 (404 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02390.1 68414.m00185 phospholipid/glycerol acyltransferase f... 30 0.51 At4g30100.1 68417.m04280 tRNA-splicing endonuclease positive eff... 29 1.6 At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding famil... 28 2.7 At1g10390.1 68414.m01171 nucleoporin family protein contains Pfa... 28 2.7 At5g66100.1 68418.m08327 La domain-containing protein similar to... 27 3.6 At5g55960.1 68418.m06979 expressed protein 27 3.6 At2g13790.1 68415.m01522 leucine-rich repeat family protein / pr... 27 3.6 At5g65440.1 68418.m08230 expressed protein 27 4.8 At1g70770.1 68414.m08158 expressed protein 27 4.8 At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar... 27 6.3 At3g22830.1 68416.m02877 heat shock transcription factor family ... 26 8.3 >At1g02390.1 68414.m00185 phospholipid/glycerol acyltransferase family protein contains Pfam profile PF01553: Acyltransferase Length = 530 Score = 30.3 bits (65), Expect = 0.51 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = -2 Query: 250 RSPNGKALNAATSIHNPAHNTQVHRSCKEPFFLRN 146 R +G+ L TS ++P+H + + C+E +F+RN Sbjct: 206 RLGSGRRLIGITSFNSPSHRSLFSQFCQEIYFVRN 240 >At4g30100.1 68417.m04280 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 1311 Score = 28.7 bits (61), Expect = 1.6 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = -1 Query: 326 PITRSIRQFPVTLSGSPSDGDPRLA--SFPK 240 P TRSI P + SG+PS+ D +L+ +FP+ Sbjct: 1239 PRTRSIDMHPESRSGTPSEDDKKLSTTTFPR 1269 >At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding family protein / CHD family protein similar to chromatin remodeling factor CHD3 (PICKLE) [Arabidopsis thaliana] GI:6478518; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00628: PHD-finger, PF00385: 'chromo' (CHRromatin Organization MOdifier) Length = 2228 Score = 27.9 bits (59), Expect = 2.7 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -2 Query: 334 PIYQSQDQYGNSQSHSPGPPQTATQDLPRSPN-GKALNAATSIHNP 200 P+++ D G H P T +LP P+ G + A TS + P Sbjct: 1825 PLFEPSDHLGFRSEHFPPMANLCTDNLPGEPSAGPSERAGTSTNIP 1870 >At1g10390.1 68414.m01171 nucleoporin family protein contains Pfam profiles: PF04096 nucleoporin autopeptidase, PF03093 nucleoporin FG repeat family Length = 1041 Score = 27.9 bits (59), Expect = 2.7 Identities = 22/94 (23%), Positives = 35/94 (37%) Frame = -2 Query: 325 QSQDQYGNSQSHSPGPPQTATQDLPRSPNGKALNAATSIHNPAHNTQVHRSCKEPFFLRN 146 QSQ +GN+ S P +P+ + A ++ A +T + P F + Sbjct: 130 QSQPAFGNTSFGSSTPFGATNTPAFGAPSTPSFGATSTPSFGASSTPAFGATNTPAFGAS 189 Query: 145 KM*NFARCQIPHWGPGSIPALGRLTFSRTFSRVG 44 +F P +G PA G + TF G Sbjct: 190 NSPSFGATNTPAFGASPTPAFG--STGTTFGNTG 221 >At5g66100.1 68418.m08327 La domain-containing protein similar to SP|P40796 La protein homolog (La ribonucleoprotein) (La autoantigen homolog) {Drosophila melanogaster}; contains Pfam profile PF05383: La domain Length = 453 Score = 27.5 bits (58), Expect = 3.6 Identities = 12/54 (22%), Positives = 27/54 (50%) Frame = -2 Query: 346 SVREPIYQSQDQYGNSQSHSPGPPQTATQDLPRSPNGKALNAATSIHNPAHNTQ 185 S++ P + + + S S PPQ + + G +++A +S ++ +N+Q Sbjct: 112 SIKSPSLDASKPFPDGSSSSIPPPQATSNTSTNANAGSSVSATSSENSAVNNSQ 165 >At5g55960.1 68418.m06979 expressed protein Length = 648 Score = 27.5 bits (58), Expect = 3.6 Identities = 11/38 (28%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -2 Query: 319 QDQYGNSQSHSP-GPPQTATQDLPRSPNGKALNAATSI 209 Q+ + ++ S P PP +++ PR P+G ++ TS+ Sbjct: 21 QEMFRSASSRKPQDPPSSSSSSPPRKPSGDGSSSKTSL 58 >At2g13790.1 68415.m01522 leucine-rich repeat family protein / protein kinase family protein Length = 620 Score = 27.5 bits (58), Expect = 3.6 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 304 NSQSHSPGPPQTATQDLPRSPNGKALNAA 218 NS + P PP T+T P P+G + AA Sbjct: 203 NSLTDLPEPPPTSTSPTPPPPSGGQMTAA 231 >At5g65440.1 68418.m08230 expressed protein Length = 1050 Score = 27.1 bits (57), Expect = 4.8 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 27 NAPHFSPTLEKVRLKVSRPRAGILPGPQCGI 119 + P T+ K++L+V R + G+ P P C I Sbjct: 206 SVPKSKKTIGKIKLQVRRIKMGLDPPPGCNI 236 >At1g70770.1 68414.m08158 expressed protein Length = 610 Score = 27.1 bits (57), Expect = 4.8 Identities = 20/58 (34%), Positives = 25/58 (43%) Frame = -3 Query: 369 NLAVVVGKVSGNPSTNHKINTAIPSHTLRVPLRRRPKTCLVPQMGRLLTPPPAFTILL 196 NL VVG + NP + I + L P R + G L PPP+F ILL Sbjct: 330 NLLPVVGNKNCNPQSRDLILQLVEK-ILTNPKARTILVNGAVRKGERLIPPPSFEILL 386 >At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar to RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00397: WW domain Length = 713 Score = 26.6 bits (56), Expect = 6.3 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 235 SHLGNEASLGSPSEGDPESVTGN 303 S LGN +S GS + G P S GN Sbjct: 114 SGLGNASSGGSSARGPPSSAAGN 136 >At3g22830.1 68416.m02877 heat shock transcription factor family protein contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 406 Score = 26.2 bits (55), Expect = 8.3 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = -2 Query: 319 QDQYGNSQSHSPGPPQTATQDLPRSPNGKALNAATSIHNPAHNTQVHRSCKEPFFLR 149 ++++ S SP PP +++ S A+N T++ P +H S PF + Sbjct: 9 KEEFPAGFSDSPSPPSSSSYLYSSSMAEAAINDPTTLSYPQPLEGLHESGPPPFLTK 65 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,933,221 Number of Sequences: 28952 Number of extensions: 221875 Number of successful extensions: 566 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 565 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 595686720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -