BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_D01 (541 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. 26 0.24 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 22 3.0 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 9.2 AJ888865-1|CAI61930.1| 108|Tribolium castaneum modulator of act... 21 9.2 AJ622939-1|CAF22091.1| 108|Tribolium castaneum ETS activity mod... 21 9.2 >Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. Length = 72 Score = 25.8 bits (54), Expect = 0.24 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +1 Query: 94 QHLVGEIVFGVAHIFASFNDTFVHVTDLSGRETI 195 +H+VG IV V ++ SFN T +V D RE I Sbjct: 21 EHMVGTIVVVVRGVWVSFNQTAQNV-DTFVREQI 53 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 22.2 bits (45), Expect = 3.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 10 EVSKLKAKPWPLRKNKVAKE 69 EV+ L+ + W L KNKV + Sbjct: 396 EVTVLEIEDWVLLKNKVTSD 415 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 152 SLKEANMCATPNTISPTK 99 ++ E C+TP SPTK Sbjct: 427 NVNENQDCSTPTENSPTK 444 >AJ888865-1|CAI61930.1| 108|Tribolium castaneum modulator of activity of ets genes protein. Length = 108 Score = 20.6 bits (41), Expect = 9.2 Identities = 11/41 (26%), Positives = 15/41 (36%) Frame = -2 Query: 462 PACGVRRHRGHIFNAANLHAGTSESTESRLGTRSRSLCLVT 340 P R H N G E SR ++LCL++ Sbjct: 36 PRQWTREHVAQWINLVTQQHGLPEVPSSRFLMNGKALCLMS 76 >AJ622939-1|CAF22091.1| 108|Tribolium castaneum ETS activity modulator protein. Length = 108 Score = 20.6 bits (41), Expect = 9.2 Identities = 11/41 (26%), Positives = 15/41 (36%) Frame = -2 Query: 462 PACGVRRHRGHIFNAANLHAGTSESTESRLGTRSRSLCLVT 340 P R H N G E SR ++LCL++ Sbjct: 36 PRQWTREHVAQWINLVTQQHGLPEVPSSRFLMNGKALCLMS 76 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.316 0.130 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,254 Number of Sequences: 336 Number of extensions: 2900 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13201902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -