BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_C23 (513 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146737-1|AAO12097.1| 119|Anopheles gambiae odorant-binding pr... 23 6.1 AJ697722-1|CAG26915.1| 119|Anopheles gambiae putative odorant-b... 23 6.1 >AY146737-1|AAO12097.1| 119|Anopheles gambiae odorant-binding protein AgamOBP27 protein. Length = 119 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -1 Query: 165 KIFN*LVPHFQITYLFTGIKAICCFY*NSYKAF 67 K++N + TY T C Y N YK++ Sbjct: 83 KVYNICTDNVTPTYCVTAFDVYQCIYENVYKSW 115 >AJ697722-1|CAG26915.1| 119|Anopheles gambiae putative odorant-binding protein OBPjj12 protein. Length = 119 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -1 Query: 165 KIFN*LVPHFQITYLFTGIKAICCFY*NSYKAF 67 K++N + TY T C Y N YK++ Sbjct: 83 KVYNICTDNVTPTYCVTAFDVYQCIYENVYKSW 115 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 483,298 Number of Sequences: 2352 Number of extensions: 8246 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46514490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -