BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_C23 (513 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 p... 32 0.20 At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ... 31 0.34 At4g29830.1 68417.m04246 transducin family protein / WD-40 repea... 31 0.46 At3g53390.1 68416.m05892 transducin family protein / WD-40 repea... 30 0.80 At2g37160.1 68415.m04559 transducin family protein / WD-40 repea... 29 1.4 At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless... 29 1.8 At4g01860.2 68417.m00244 transducin family protein / WD-40 repea... 29 2.4 At4g01860.1 68417.m00243 transducin family protein / WD-40 repea... 29 2.4 At4g21130.1 68417.m03055 transducin family protein / WD-40 repea... 28 3.2 At4g11270.1 68417.m01823 transducin family protein / WD-40 repea... 28 3.2 At1g49540.1 68414.m05553 transducin family protein / WD-40 repea... 28 4.2 At5g17370.1 68418.m02036 WD-40 repeat family protein contains 1 ... 27 5.6 At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p... 27 5.6 At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p... 27 5.6 At1g19070.1 68414.m02373 F-box family protein similar to putativ... 27 7.4 At5g64730.1 68418.m08140 transducin family protein / WD-40 repea... 27 9.8 At5g49430.1 68418.m06116 transducin family protein / WD-40 repea... 27 9.8 At3g49400.1 68416.m05400 transducin family protein / WD-40 repea... 27 9.8 At2g47410.1 68415.m05917 transducin family protein / WD-40 repea... 27 9.8 >At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 1187 Score = 32.3 bits (70), Expect = 0.20 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 396 GDSKQASKSYIVTGGLDCLVKVWTCENNKLEFCNSLKGH 512 GD + A + ++G DCLVK+W E +LKGH Sbjct: 862 GDREDAG--FFISGSTDCLVKIWDPSLRGSELRATLKGH 898 >At5g13480.1 68418.m01554 WD-40 repeat family protein similar to WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens}; contains 3 weak Pfam PF00400: WD domain, G-beta repeats; Length = 711 Score = 31.5 bits (68), Expect = 0.34 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +3 Query: 414 SKSYIVTGGLDCLVKVWTCENNKLEFCNSLKGH 512 +KS +V+GG D LVK+W + + E C SL GH Sbjct: 279 TKSLLVSGGKDQLVKLWDTRSGR-ELC-SLHGH 309 >At4g29830.1 68417.m04246 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); G protein beta subunit-like protein, Schistosoma mansoni, gb:U30261 Length = 321 Score = 31.1 bits (67), Expect = 0.46 Identities = 16/58 (27%), Positives = 31/58 (53%) Frame = +3 Query: 339 ENAHDDPIYSCSWTNFNASGDSKQASKSYIVTGGLDCLVKVWTCENNKLEFCNSLKGH 512 ENAH+D +++ +W + + + ++TG LD VK+W ++L+ + GH Sbjct: 10 ENAHEDSVWAATWV------PATEDRPALLLTGSLDETVKLW--RPDELDLVRTNTGH 59 >At3g53390.1 68416.m05892 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to Dystrophia myotonica-containing WD repeat motif protein DMR-N9 protein (DMWD) (DM9) (SP:Q08274) [Mus musculus]; simlar to DMR protein GI:18028289 [Homo sapiens]; Length = 558 Score = 30.3 bits (65), Expect = 0.80 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +3 Query: 423 YIVTGGLDCLVKVWTCENNKL 485 YI+TGG D LV+VW+ E+ K+ Sbjct: 359 YILTGGEDDLVQVWSMEDRKV 379 >At2g37160.1 68415.m04559 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to Dystrophia myotonica-containing WD repeat motif protein DMR-N9 protein (DMWD) (DM9) (SP:Q08274) [Mus musculus]; simlar to DMR protein GI:18028289 [Homo sapiens]; Length = 544 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = +3 Query: 423 YIVTGGLDCLVKVWTCENNKL 485 Y++TGG D LV+VW+ E+ K+ Sbjct: 359 YLLTGGEDDLVQVWSMEDRKV 379 >At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless protein, putative similar to notchless [Xenopus laevis] GI:3687833; contains Pfam PF00400: WD domain, G-beta repeat (8 copies) Length = 473 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +3 Query: 405 KQASKSYIVTGGLDCLVKVWTCENNKLEFCNSLKGH 512 K I TG DC +K+W KL LKGH Sbjct: 248 KWGGDGIIYTGSQDCTIKMWETTQGKL--IRELKGH 281 >At4g01860.2 68417.m00244 transducin family protein / WD-40 repeat family protein contains ten G-protein beta-subunit (beta-transducin) WD-40 repeats Length = 1308 Score = 28.7 bits (61), Expect = 2.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 414 SKSYIVTGGLDCLVKVWTCENNKLE 488 S S IVT G DC +VW + +LE Sbjct: 287 SDSLIVTAGEDCTCRVWGVDGTQLE 311 >At4g01860.1 68417.m00243 transducin family protein / WD-40 repeat family protein contains ten G-protein beta-subunit (beta-transducin) WD-40 repeats Length = 1308 Score = 28.7 bits (61), Expect = 2.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 414 SKSYIVTGGLDCLVKVWTCENNKLE 488 S S IVT G DC +VW + +LE Sbjct: 287 SDSLIVTAGEDCTCRVWGVDGTQLE 311 >At4g21130.1 68417.m03055 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); some similarity to a group of proteins with homology to mammalian apoptosis regulators identified in zebrafish (PUBMED:10917738)Apaf-1(gi:7677507) Length = 537 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 423 YIVTGGLDCLVKVWTCENNKLEFCNSLKGH 512 Y+ TGG+DC V +W + N LK + Sbjct: 220 YLATGGVDCHVHLWDIRTREHVQVNKLKNN 249 >At4g11270.1 68417.m01823 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); related to TGF-beta resistance-associated protein TRAG (GI:15624071) {Mus musculus}; similar to beta-transducin repeats containing protein - Homo sapiens,PID:e1284220; 3' EST no_NP:TC8031 Length = 1446 Score = 28.3 bits (60), Expect = 3.2 Identities = 8/31 (25%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +3 Query: 396 GDSKQASKSYI-VTGGLDCLVKVWTCENNKL 485 GD+ + S++ ++G +DC +++W E+ + Sbjct: 541 GDANGCNSSHVLISGSMDCTIRIWDLESGNV 571 >At1g49540.1 68414.m05553 transducin family protein / WD-40 repeat family protein similar to signal transducer and activator of transcription interacting protein 1 (GI:15929722) {Mus musculus}; similar to hypothetical protein GB:AAD43147 GI:5430747 from (Arabidopsis thaliana); contains Pfam PF00400: WD domain, G-beta repeat (11 copies, 2 weak) Length = 840 Score = 27.9 bits (59), Expect = 4.2 Identities = 18/54 (33%), Positives = 24/54 (44%) Frame = +3 Query: 318 HSLLFKKENAHDDPIYSCSWTNFNASGDSKQASKSYIVTGGLDCLVKVWTCENN 479 H L+ K E AH I++CSW F T D VK+W+ EN+ Sbjct: 686 HKLMAKVE-AHKRIIWACSWNPFG----------HQFATSSRDKTVKIWSVEND 728 >At5g17370.1 68418.m02036 WD-40 repeat family protein contains 1 significant, 2 weak WD-40 repeats (PF00400); similar to transducin beta-like 1 protein.(SP:O60907) [Homo sapiens] Length = 467 Score = 27.5 bits (58), Expect = 5.6 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +3 Query: 414 SKSYIVTGGLDCLVKVWTCENNKL 485 S+ +I++GG DC ++W+ ++ +L Sbjct: 399 SERFILSGGDDCYTRIWSIKSGQL 422 >At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p80 subunit, putative contains 5 WD-40 repeats (PF00400); similar to katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 1180 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 423 YIVTGGLDCLVKVWTCENNKL 485 ++V+GGLD +VKVW KL Sbjct: 156 WVVSGGLDNVVKVWDLTAGKL 176 >At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80 subunit, putative similar to contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 974 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 423 YIVTGGLDCLVKVWTCENNKL 485 ++V+GGLD +VKVW KL Sbjct: 105 WVVSGGLDNVVKVWDLTAGKL 125 >At1g19070.1 68414.m02373 F-box family protein similar to putative non-LTR retroelement reverse transcriptase GI:3738337 from [Arabidopsis thaliana] ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 83 Score = 27.1 bits (57), Expect = 7.4 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 234 LNWLT*SVICWVLLF*PVKESVMTT 308 +N L+ +IC +L F P KES +T+ Sbjct: 4 INGLSDEIICHILSFLPTKESALTS 28 >At5g64730.1 68418.m08140 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to Will die slowly protein (SP:Q9V3J8) [Fruit fly] {Drosophila m.] Length = 299 Score = 26.6 bits (56), Expect = 9.8 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 414 SKSYIVTGGLDCLVKVWTCENNKLE 488 S S +V+ G D ++VW C ++ +E Sbjct: 113 SSSVVVSAGFDRSLRVWDCRSHSVE 137 >At5g49430.1 68418.m06116 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein 9 (SP:Q9NSI6) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies) Length = 1677 Score = 26.6 bits (56), Expect = 9.8 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 414 SKSYIVTGGLDCLVKVWTCENNKLEFC-NSLKGH 512 S Y++TG D LVKVW+ + +C S +GH Sbjct: 256 SGRYVITGSDDRLVKVWSMDT---AYCLASCRGH 286 >At3g49400.1 68416.m05400 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); low similarity (47%) to Agamous-like MADS box protein AGL5 (SP:P29385) {Arabidopsis thaliana} Length = 892 Score = 26.6 bits (56), Expect = 9.8 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +3 Query: 348 HDDPIYSCSWTNFNASGDSKQASKSYIVTGGLDCLVKVWTCENNKLEFCNSLK 506 H + + SW F + Q +VTG D VK+W +NK + NS++ Sbjct: 322 HSSWVSTMSWGIFGCDSSNPQV---VLVTGSCDGSVKIWM--SNKEDLQNSVE 369 >At2g47410.1 68415.m05917 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to WDR protein, form B (GI:14970593) [Mus musculus] Length = 1589 Score = 26.6 bits (56), Expect = 9.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 414 SKSYIVTGGLDCLVKVWTCE 473 S Y++TG D LVK+W+ E Sbjct: 316 SGRYVITGSDDRLVKIWSME 335 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,904,501 Number of Sequences: 28952 Number of extensions: 177957 Number of successful extensions: 456 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 456 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 927799552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -