BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_C20 (452 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 26 0.71 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 25 0.94 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 25 1.2 L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 23 3.8 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 23 3.8 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 23 3.8 AY341209-1|AAR13773.1| 196|Anopheles gambiae SP14D1 protein. 23 5.0 AY341208-1|AAR13772.1| 196|Anopheles gambiae SP14D1 protein. 23 5.0 AY341207-1|AAR13771.1| 196|Anopheles gambiae SP14D1 protein. 23 5.0 AY341206-1|AAR13770.1| 196|Anopheles gambiae SP14D1 protein. 23 5.0 AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocas... 23 5.0 AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 23 6.7 DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. 22 8.8 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 22 8.8 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 25.8 bits (54), Expect = 0.71 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -2 Query: 391 GFPERTTHPSLEPISSSARQHFIDADDM 308 G P+ T HP L S SA Q F D M Sbjct: 91 GLPDITRHPWLVTASQSALQKFASTDWM 118 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 25.4 bits (53), Expect = 0.94 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -1 Query: 302 GVVSSGC-GTDLYRSSLRGTCCNRYGLLPAPQNSAAR 195 G GC D S +G+ CN+YG P N R Sbjct: 978 GFSEDGCHACDCDPSGSKGSQCNQYGQCPCNDNVEGR 1014 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 25.0 bits (52), Expect = 1.2 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +2 Query: 200 QLSSEALEAGRICCNKYLVKNCGKDQFHIRMRLH 301 +L+ E L G CN + K CGK HIR H Sbjct: 487 RLTFERLSGG---CNLHRCKLCGKVVTHIRNHYH 517 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 23.4 bits (48), Expect = 3.8 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 1/76 (1%) Frame = -1 Query: 305 RGVVSSGCGTDLYRSSLRGTCCNRYGLLPAPQNSAARTHQTLSARI-VGSHPLSLSFCPS 129 RG S G +YR++ G G+LP P+N++ ++ + S +S F Sbjct: 177 RGFNVSVQGIIIYRAAYFGCFDTAKGMLPDPKNTSIFVSWAIAQVVTTASGIISYPFDTV 236 Query: 128 RKYGSLGQAHPDKTEI 81 R+ + Q+ P K+E+ Sbjct: 237 RR-RMMMQSWPCKSEV 251 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 23.4 bits (48), Expect = 3.8 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 1/76 (1%) Frame = -1 Query: 305 RGVVSSGCGTDLYRSSLRGTCCNRYGLLPAPQNSAARTHQTLSARI-VGSHPLSLSFCPS 129 RG S G +YR++ G G+LP P+N++ ++ + S +S F Sbjct: 177 RGFNVSVQGIIIYRAAYFGCFDTAKGMLPDPKNTSIFVSWAIAQVVTTASGIISYPFDTV 236 Query: 128 RKYGSLGQAHPDKTEI 81 R+ + Q+ P K+E+ Sbjct: 237 RR-RMMMQSWPCKSEV 251 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 23.4 bits (48), Expect = 3.8 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 68 YSYNIDNISLVGAPLC 21 Y+Y + + L G+PLC Sbjct: 899 YAYQLHRMQLTGSPLC 914 >AY341209-1|AAR13773.1| 196|Anopheles gambiae SP14D1 protein. Length = 196 Score = 23.0 bits (47), Expect = 5.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 442 AYRHNGLSNTHTRYCALGFPERTT 371 AY+ NG+S T+ CA G + T Sbjct: 119 AYQRNGISLDSTQMCAGGIRGKDT 142 >AY341208-1|AAR13772.1| 196|Anopheles gambiae SP14D1 protein. Length = 196 Score = 23.0 bits (47), Expect = 5.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 442 AYRHNGLSNTHTRYCALGFPERTT 371 AY+ NG+S T+ CA G + T Sbjct: 119 AYQRNGISLDSTQMCAGGIRGKDT 142 >AY341207-1|AAR13771.1| 196|Anopheles gambiae SP14D1 protein. Length = 196 Score = 23.0 bits (47), Expect = 5.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 442 AYRHNGLSNTHTRYCALGFPERTT 371 AY+ NG+S T+ CA G + T Sbjct: 119 AYQRNGISLDSTQMCAGGIRGKDT 142 >AY341206-1|AAR13770.1| 196|Anopheles gambiae SP14D1 protein. Length = 196 Score = 23.0 bits (47), Expect = 5.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 442 AYRHNGLSNTHTRYCALGFPERTT 371 AY+ NG+S T+ CA G + T Sbjct: 119 AYQRNGISLDSTQMCAGGIRGKDT 142 >AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocase protein. Length = 301 Score = 23.0 bits (47), Expect = 5.0 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 305 RGVVSSGCGTDLYRSSLRGTCCNRYGLLPAPQNSA 201 RG S G +YR++ G G+LP P+N++ Sbjct: 177 RGFNVSVQGIIIYRAAYFGCFDTAKGMLPDPKNTS 211 >AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. Length = 194 Score = 22.6 bits (46), Expect = 6.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 149 TVDDFPLCVHLVSDEYEQL 205 T + P +HL+ +EY++L Sbjct: 84 TCETLPSEIHLIKEEYDEL 102 >DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. Length = 391 Score = 22.2 bits (45), Expect = 8.8 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +2 Query: 260 NCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARV 412 NC +H+R+ L F+ + AGA +Q + AFG P+ A + Sbjct: 47 NCAVSPYHVRLALSMFYPL--------AGA-AVQEDFQVAFGLPEDVHAAI 88 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 22.2 bits (45), Expect = 8.8 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 110 PKIRIFDLGKKRATVD 157 P I +++ KKRAT+D Sbjct: 1103 PDILVYEKRKKRATID 1118 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 538,328 Number of Sequences: 2352 Number of extensions: 11339 Number of successful extensions: 26 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 38694201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -