BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_C19 (348 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC664.05 |rpl13||60S ribosomal protein L13|Schizosaccharomyces... 125 2e-30 SPCC61.05 |||S. pombe specific multicopy membrane protein family... 27 0.83 SPCC1281.01 |ags1|mok1, SPCC338.01c, SPCC17A7.01|alpha-1,4-gluca... 25 4.4 SPBC16D10.05 |mok13||alpha-1,3-glucan synthase Mok13|Schizosacch... 24 7.8 >SPAC664.05 |rpl13||60S ribosomal protein L13|Schizosaccharomyces pombe|chr 1|||Manual Length = 208 Score = 125 bits (302), Expect = 2e-30 Identities = 58/102 (56%), Positives = 72/102 (70%) Frame = +1 Query: 37 IPNGHFHKDWQRFVKTWFNQPARRHRRKQNRIXXXXXXXXXXXXXXLRPVVRCPTVRYHT 216 +PN HFHKDWQR+VKTWFNQP R+ RR+Q R +RP V+ PT+RY+ Sbjct: 9 LPNAHFHKDWQRYVKTWFNQPGRKLRRRQAR-QTKAAKIAPRPVEAIRPAVKPPTIRYNM 67 Query: 217 KVRAGRGFTLREIRASGLNPSFARTIGIAVDPRRRNKSVESL 342 KVRAGRGFTL E++A+G++ A TIGI VD RRRN+S ESL Sbjct: 68 KVRAGRGFTLEELKAAGVSRRVASTIGIPVDHRRRNRSEESL 109 >SPCC61.05 |||S. pombe specific multicopy membrane protein family 1|Schizosaccharomyces pombe|chr 3|||Manual Length = 469 Score = 27.1 bits (57), Expect = 0.83 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -1 Query: 138 LFYSILLSTMTTSWLIKPCLHKS--LPILMEMAIWYHIIPFTH 16 L S+ L +T +WL++ +S P + +A W I FTH Sbjct: 204 LAISMFLGFITLTWLLRCIKSQSGVQPAQISLAFWVFIFVFTH 246 >SPCC1281.01 |ags1|mok1, SPCC338.01c, SPCC17A7.01|alpha-1,4-glucan synthase Ags1|Schizosaccharomyces pombe|chr 3|||Manual Length = 2410 Score = 24.6 bits (51), Expect = 4.4 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = -1 Query: 144 FSLFYSILLSTMTTSWLIKPCLHKSLPILMEMAIWY 37 FSL + + T W+ + CL + + + A+WY Sbjct: 2094 FSLNFGEEGAVQTRIWVFRACLVQGVQQVWSAALWY 2129 >SPBC16D10.05 |mok13||alpha-1,3-glucan synthase Mok13|Schizosaccharomyces pombe|chr 2|||Manual Length = 2358 Score = 23.8 bits (49), Expect = 7.8 Identities = 8/36 (22%), Positives = 16/36 (44%) Frame = -1 Query: 144 FSLFYSILLSTMTTSWLIKPCLHKSLPILMEMAIWY 37 FSL + SW+++ C+ + + +WY Sbjct: 2040 FSLNFGDEAGAGVVSWIVRACIVQGFQQIWACCLWY 2075 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,415,035 Number of Sequences: 5004 Number of extensions: 23664 Number of successful extensions: 68 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 104153322 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -