BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_C15 (339 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 34 0.001 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 24 1.8 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 24 1.8 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 2.4 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 22 7.3 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 34.3 bits (75), Expect = 0.001 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +1 Query: 214 EVTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDPTPIQ 336 +V VSG P+ +E FE + + V ++ Y PTPIQ Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQ 201 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 265 EANFPDYVCQAIKSMGYK 318 +AN DY C + S+G+K Sbjct: 280 DANASDYFCSSTSSVGFK 297 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 265 EANFPDYVCQAIKSMGYK 318 +AN DY C + S+G+K Sbjct: 280 DANASDYFCSSTSSVGFK 297 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +1 Query: 133 FNKDFYNPHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEH 258 ++ D + +V+ R P V+ + H+V V V P+ H Sbjct: 128 YHADHHTGFNAVVRREPSAVKIAQPVHKVIAQPVHVHAPVAH 169 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 21.8 bits (44), Expect = 7.3 Identities = 8/17 (47%), Positives = 14/17 (82%) Frame = -1 Query: 162 FMRIIKIFVKWLERQRI 112 FMR++K V++ ER++I Sbjct: 248 FMRVVKDTVEYREREQI 264 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.317 0.134 0.423 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 316,975 Number of Sequences: 2352 Number of extensions: 5104 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 24206952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -