BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_C15 (339 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g55150.1 68414.m06298 DEAD box RNA helicase, putative (RH20) ... 77 3e-15 At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helica... 68 1e-12 At5g63120.1 68418.m07925 ethylene-responsive DEAD box RNA helica... 68 1e-12 At2g47330.1 68415.m05908 DEAD/DEAH box helicase, putative simila... 64 2e-11 At3g01540.3 68416.m00084 DEAD box RNA helicase (DRH1) identical ... 54 2e-08 At3g01540.2 68416.m00083 DEAD box RNA helicase (DRH1) identical ... 54 2e-08 At3g01540.1 68416.m00082 DEAD box RNA helicase (DRH1) identical ... 54 2e-08 At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar... 54 2e-08 At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar... 53 4e-08 At3g09620.1 68416.m01141 DEAD/DEAH box helicase, putative simila... 52 7e-08 At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA... 45 1e-05 At5g51280.1 68418.m06357 DEAD-box protein abstrakt, putative 42 1e-04 At2g33730.1 68415.m04134 DEAD box RNA helicase, putative similar... 39 7e-04 At3g09720.1 68416.m01151 DEAD/DEAH box helicase, putative simila... 38 0.002 At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar... 36 0.007 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 34 0.021 At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28)... 31 0.15 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 31 0.15 At1g77050.1 68414.m08971 DEAD/DEAH box helicase, putative simila... 31 0.15 At5g52530.2 68418.m06518 dentin sialophosphoprotein-related cont... 31 0.20 At5g52530.1 68418.m06517 dentin sialophosphoprotein-related cont... 31 0.20 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 31 0.20 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 31 0.20 At3g02065.2 68416.m00170 DEAD/DEAH box helicase family protein c... 31 0.20 At4g33830.1 68417.m04801 glycosyl hydrolase family 10 protein xy... 28 1.4 At1g51380.1 68414.m05780 eukaryotic translation initiation facto... 28 1.8 At4g31540.1 68417.m04478 exocyst subunit EXO70 family protein (E... 27 2.4 At2g26160.1 68415.m03139 F-box family protein contains F-box dom... 27 4.2 At3g08820.1 68416.m01024 pentatricopeptide (PPR) repeat-containi... 26 5.6 At2g39710.1 68415.m04872 aspartyl protease family protein contai... 26 7.4 At2g01830.3 68415.m00115 histidine kinase (AHK4) (WOL) identical... 26 7.4 At2g01830.2 68415.m00116 histidine kinase (AHK4) (WOL) identical... 26 7.4 At2g01830.1 68415.m00114 histidine kinase (AHK4) (WOL) identical... 26 7.4 At1g12770.1 68414.m01482 DEAD/DEAH box helicase family protein /... 26 7.4 At5g50220.1 68418.m06220 F-box family protein contains F-box dom... 25 9.7 At4g36100.1 68417.m05138 expressed protein contains Pfam domain,... 25 9.7 At4g34080.1 68417.m04835 expressed protein contains Pfam profile... 25 9.7 At3g05790.1 68416.m00650 Lon protease, putative similar to Lon p... 25 9.7 At2g45260.1 68415.m05634 expressed protein contains Pfam profile... 25 9.7 At1g77360.1 68414.m09009 pentatricopeptide (PPR) repeat-containi... 25 9.7 >At1g55150.1 68414.m06298 DEAD box RNA helicase, putative (RH20) similar to ethylene-responsive RNA helicase GI:5669638 from [Lycopersicon esculentum]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 501 Score = 77.0 bits (181), Expect = 3e-15 Identities = 31/72 (43%), Positives = 46/72 (63%) Frame = +1 Query: 124 LQPFNKDFYNPHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVCQAIK 303 L PF K+FY +V + EVE+YR E+TV G ++P P++ F + FPDYV + +K Sbjct: 56 LTPFEKNFYVESPAVAAMTDTEVEEYRKLREITVEGKDIPKPVKSFRDVGFPDYVLEEVK 115 Query: 304 SMGYKDPTPIQA 339 G+ +PTPIQ+ Sbjct: 116 KAGFTEPTPIQS 127 >At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helicase, putative (RH30) strong similarity to ethylene-responsive RNA helicase [Lycopersicon esculentum] GI:5669638; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 591 Score = 68.1 bits (159), Expect = 1e-12 Identities = 29/73 (39%), Positives = 48/73 (65%) Frame = +1 Query: 121 SLQPFNKDFYNPHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVCQAI 300 +L F K+FY +V + +V YR + +++V G +VP P++ F++ANFPD + +AI Sbjct: 121 NLVHFEKNFYVESPTVQAMTEQDVAMYRTERDISVEGRDVPKPMKMFQDANFPDNILEAI 180 Query: 301 KSMGYKDPTPIQA 339 +G+ +PTPIQA Sbjct: 181 AKLGFTEPTPIQA 193 >At5g63120.1 68418.m07925 ethylene-responsive DEAD box RNA helicase, putative (RH30) strong similarity to ethylene-responsive RNA helicase [Lycopersicon esculentum] GI:5669638; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 484 Score = 68.1 bits (159), Expect = 1e-12 Identities = 29/73 (39%), Positives = 48/73 (65%) Frame = +1 Query: 121 SLQPFNKDFYNPHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVCQAI 300 +L F K+FY +V + +V YR + +++V G +VP P++ F++ANFPD + +AI Sbjct: 121 NLVHFEKNFYVESPTVQAMTEQDVAMYRTERDISVEGRDVPKPMKMFQDANFPDNILEAI 180 Query: 301 KSMGYKDPTPIQA 339 +G+ +PTPIQA Sbjct: 181 AKLGFTEPTPIQA 193 >At2g47330.1 68415.m05908 DEAD/DEAH box helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 760 Score = 64.1 bits (149), Expect = 2e-11 Identities = 28/74 (37%), Positives = 41/74 (55%) Frame = +1 Query: 115 SLSLQPFNKDFYNPHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVCQ 294 S+ +P NKDFY +S+ + E DYR + + VSG +V P++ FE+ F + Sbjct: 182 SIDYEPINKDFYEELESISGMTEQETTDYRQRLGIRVSGFDVHRPVKTFEDCGFSSQIMS 241 Query: 295 AIKSMGYKDPTPIQ 336 AIK Y+ PT IQ Sbjct: 242 AIKKQAYEKPTAIQ 255 >At3g01540.3 68416.m00084 DEAD box RNA helicase (DRH1) identical to RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 619 Score = 54.4 bits (125), Expect = 2e-08 Identities = 26/62 (41%), Positives = 34/62 (54%) Frame = +1 Query: 154 PHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDPTPI 333 P S S E Y +HE+TVSG +VP P+ FE FP + + + S G+ PTPI Sbjct: 125 PLPSSAPASELSPEAYSRRHEITVSGGQVPPPLMSFEATGFPPELLREVLSAGFSAPTPI 184 Query: 334 QA 339 QA Sbjct: 185 QA 186 >At3g01540.2 68416.m00083 DEAD box RNA helicase (DRH1) identical to RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 619 Score = 54.4 bits (125), Expect = 2e-08 Identities = 26/62 (41%), Positives = 34/62 (54%) Frame = +1 Query: 154 PHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDPTPI 333 P S S E Y +HE+TVSG +VP P+ FE FP + + + S G+ PTPI Sbjct: 125 PLPSSAPASELSPEAYSRRHEITVSGGQVPPPLMSFEATGFPPELLREVLSAGFSAPTPI 184 Query: 334 QA 339 QA Sbjct: 185 QA 186 >At3g01540.1 68416.m00082 DEAD box RNA helicase (DRH1) identical to RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 618 Score = 54.4 bits (125), Expect = 2e-08 Identities = 26/62 (41%), Positives = 34/62 (54%) Frame = +1 Query: 154 PHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDPTPI 333 P S S E Y +HE+TVSG +VP P+ FE FP + + + S G+ PTPI Sbjct: 125 PLPSSAPASELSPEAYSRRHEITVSGGQVPPPLMSFEATGFPPELLREVLSAGFSAPTPI 184 Query: 334 QA 339 QA Sbjct: 185 QA 186 >At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar to RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00397: WW domain Length = 1088 Score = 54.0 bits (124), Expect = 2e-08 Identities = 27/70 (38%), Positives = 36/70 (51%), Gaps = 2/70 (2%) Frame = +1 Query: 136 NKDFYNPHKSVLDRSPY--EVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVCQAIKSM 309 NK PH P+ VE YR +HEVT +G +P P FE + P + + + S Sbjct: 394 NKSLVRPHFVTSPDVPHLSPVEIYRKQHEVTTTGENIPAPYITFESSGLPPEILRELLSA 453 Query: 310 GYKDPTPIQA 339 G+ PTPIQA Sbjct: 454 GFPSPTPIQA 463 >At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1166 Score = 53.2 bits (122), Expect = 4e-08 Identities = 23/73 (31%), Positives = 38/73 (52%) Frame = +1 Query: 118 LSLQPFNKDFYNPHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVCQA 297 + +PF K+FY K + + EV YR + E+ V G +VP PI+ + + + Sbjct: 484 IEYEPFRKNFYIEVKDISRMTQEEVNTYRKELELKVHGKDVPRPIKFWHQTGLTSKILDT 543 Query: 298 IKSMGYKDPTPIQ 336 +K + Y+ P PIQ Sbjct: 544 MKKLNYEKPMPIQ 556 >At3g09620.1 68416.m01141 DEAD/DEAH box helicase, putative similar to RNA helicase GB:A57514 GI:897915 from [Rattus norvegicus]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 989 Score = 52.4 bits (120), Expect = 7e-08 Identities = 23/74 (31%), Positives = 38/74 (51%) Frame = +1 Query: 118 LSLQPFNKDFYNPHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVCQA 297 + +PF K+FY K + + V YR + E+ V G +VP PI+ + + + Sbjct: 351 IEYEPFRKNFYIEVKDISRMTQDAVNAYRKELELKVHGKDVPRPIQFWHQTGLTSKILDT 410 Query: 298 IKSMGYKDPTPIQA 339 +K + Y+ P PIQA Sbjct: 411 LKKLNYEKPMPIQA 424 >At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA helicase DBP2 - Saccharomyces cerevisiae, PID:g5272 Length = 542 Score = 45.2 bits (102), Expect = 1e-05 Identities = 20/64 (31%), Positives = 36/64 (56%) Frame = +1 Query: 145 FYNPHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDP 324 ++ P V S +++ R + +TV+G ++P PI++F + FP + + +K G P Sbjct: 61 WWKPPLHVRKMSTKQMDLIRKQWHITVNGEDIPPPIKNFMDMKFPSPLLRMLKDKGIMHP 120 Query: 325 TPIQ 336 TPIQ Sbjct: 121 TPIQ 124 >At5g51280.1 68418.m06357 DEAD-box protein abstrakt, putative Length = 591 Score = 41.5 bits (93), Expect = 1e-04 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = +1 Query: 202 RNKHEVTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDPTPIQ 336 R + + V+G ++P PI++F++ FP V +K G PTPIQ Sbjct: 129 RKQWHIIVNGDDIPPPIKNFKDMKFPRPVLDTLKEKGIVQPTPIQ 173 >At2g33730.1 68415.m04134 DEAD box RNA helicase, putative similar to SP|P23394 Pre-mRNA splicing factor RNA helicase PRP28 {Saccharomyces cerevisiae}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 733 Score = 39.1 bits (87), Expect = 7e-04 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +1 Query: 199 YRNKHEVTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDPTPIQ 336 +R ++ G +P P+ +EE+ + +A++ GYK P+PIQ Sbjct: 295 FREDFNISYKGSRIPRPMRSWEESKLTSELLKAVERAGYKKPSPIQ 340 >At3g09720.1 68416.m01151 DEAD/DEAH box helicase, putative similar to RNA helicase involved in rRNA processing GB:6321267 from [Saccharomyces cerevisiae]c, ontains DEAD and DEAH box domain Length = 541 Score = 37.9 bits (84), Expect = 0.002 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 4/71 (5%) Frame = +1 Query: 136 NKDFYNPHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANF----PDYVCQAIK 303 N+ NP K L+R R ++ + VSG +P P++ F E + Y+ + + Sbjct: 99 NEIVENPKKE-LNRQMERDALSRKQYSIHVSGNNIPPPLKSFAELSSRYGCEGYILRNLA 157 Query: 304 SMGYKDPTPIQ 336 +G+K+PTPIQ Sbjct: 158 ELGFKEPTPIQ 168 >At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar to RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00397: WW domain Length = 713 Score = 35.9 bits (79), Expect = 0.007 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 193 EDYRNKHEVTVSGVEVPNPIEHFEEANFPD 282 E Y KHE+TVSG +VP P+ FE P+ Sbjct: 141 EAYCRKHEITVSGGQVPPPLMSFEATGLPN 170 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 34.3 bits (75), Expect = 0.021 Identities = 22/85 (25%), Positives = 34/85 (40%), Gaps = 3/85 (3%) Frame = +1 Query: 91 NMRRPNWD--SLSLQPFNKDFYNPHKSVLDRSPYEVE-DYRNKHEVTVSGVEVPNPIEHF 261 N R WD + PF D P + ++ + D + SG VP P+ F Sbjct: 102 NNRSGGWDRREREVNPFENDDSEPEPAFTEQDNTVINFDAYEDIPIETSGDNVPPPVNTF 161 Query: 262 EEANFPDYVCQAIKSMGYKDPTPIQ 336 E + + + I+ Y PTP+Q Sbjct: 162 AEIDLGEALNLNIRRCKYVKPTPVQ 186 >At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28) identical to cDNA DEAD box RNA helicase, RH28 GI:3776026 Length = 789 Score = 31.5 bits (68), Expect = 0.15 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +1 Query: 172 DRSPYEVEDYRNKHEV-TVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDPTPIQA 339 + + Y+ ED K TV GV + F E N + +A +++GYK PTPIQA Sbjct: 141 EAAEYKPEDATPKPFFSTVDGVSFH--ADTFMELNLSRPLLRACETLGYKKPTPIQA 195 >At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 646 Score = 31.5 bits (68), Expect = 0.15 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 3/85 (3%) Frame = +1 Query: 91 NMRRPNWDSLSLQ--PFNKDFY-NPHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEHF 261 N R WD + PF D +P + + + E Y + + SG VP P+ F Sbjct: 90 NARSGGWDRRDTETNPFGNDGNADPAVNEQENTVINFEAYEDI-PIETSGDNVPPPVNTF 148 Query: 262 EEANFPDYVCQAIKSMGYKDPTPIQ 336 E + + + I+ Y PTP+Q Sbjct: 149 AEIDLGEALNLNIQRCKYVKPTPVQ 173 >At1g77050.1 68414.m08971 DEAD/DEAH box helicase, putative similar to RNA helicase GI:3776027 from [Arabidopsis thaliana] Length = 513 Score = 31.5 bits (68), Expect = 0.15 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 Query: 259 FEEANFPDYVCQAIKSMGYKDPTPIQ 336 FE N V AIK GYK PTPIQ Sbjct: 30 FESLNLGPNVFNAIKKKGYKVPTPIQ 55 >At5g52530.2 68418.m06518 dentin sialophosphoprotein-related contains weak similarity to dentin sialophosphoprotein precursor (Dentin matrix protein-3) (DMP- 3) (Swiss-Prot:P97399) [Mus musculus] Length = 828 Score = 31.1 bits (67), Expect = 0.20 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 4/63 (6%) Frame = +1 Query: 91 NMRRPNWDSLSLQPF--NKDFYNPHKSVLDRSPYEVEDYR--NKHEVTVSGVEVPNPIEH 258 +MRRPN D+ +L+PF N+ F NP +S + +E+ R + E T G +V + Sbjct: 752 SMRRPNSDNNNLRPFIPNRRFDNPEEST-GGNRFEMTQQRRTRRSETTEDGGDVIRRFKF 810 Query: 259 FEE 267 EE Sbjct: 811 NEE 813 >At5g52530.1 68418.m06517 dentin sialophosphoprotein-related contains weak similarity to dentin sialophosphoprotein precursor (Dentin matrix protein-3) (DMP- 3) (Swiss-Prot:P97399) [Mus musculus] Length = 828 Score = 31.1 bits (67), Expect = 0.20 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 4/63 (6%) Frame = +1 Query: 91 NMRRPNWDSLSLQPF--NKDFYNPHKSVLDRSPYEVEDYR--NKHEVTVSGVEVPNPIEH 258 +MRRPN D+ +L+PF N+ F NP +S + +E+ R + E T G +V + Sbjct: 752 SMRRPNSDNNNLRPFIPNRRFDNPEEST-GGNRFEMTQQRRTRRSETTEDGGDVIRRFKF 810 Query: 259 FEE 267 EE Sbjct: 811 NEE 813 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 31.1 bits (67), Expect = 0.20 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 3/85 (3%) Frame = +1 Query: 91 NMRRPNWD--SLSLQPFNKDF-YNPHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEHF 261 N R WD + PF D P + + + + Y + V SG +VP P+ F Sbjct: 95 NNRSGGWDRREREVNPFGDDAELEPVFTEQENTGINFDAYEDI-PVETSGGDVPPPVNTF 153 Query: 262 EEANFPDYVCQAIKSMGYKDPTPIQ 336 + + D + I+ Y PTP+Q Sbjct: 154 ADIDLGDALNLNIRRCKYVRPTPVQ 178 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 31.1 bits (67), Expect = 0.20 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 3/85 (3%) Frame = +1 Query: 91 NMRRPNWD--SLSLQPFNKDF-YNPHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEHF 261 N R WD + PF D P + + + + Y + V SG +VP P+ F Sbjct: 95 NNRSGGWDRREREVNPFGDDAELEPVFTEQENTGINFDAYEDI-PVETSGGDVPPPVNTF 153 Query: 262 EEANFPDYVCQAIKSMGYKDPTPIQ 336 + + D + I+ Y PTP+Q Sbjct: 154 ADIDLGDALNLNIRRCKYVRPTPVQ 178 >At3g02065.2 68416.m00170 DEAD/DEAH box helicase family protein contains Pfam profile: PF00270 DEAD/DEAH box helicase Length = 505 Score = 31.1 bits (67), Expect = 0.20 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +1 Query: 178 SPYEVEDYRNKHEVTVSGV--EVPNPIEHFEEANFPDYVCQAIKSMGYKDPTPIQ 336 S ++ + R K ++ V G VP P+ F P + +++ GY PTPIQ Sbjct: 83 SSHDAQLLRRKLDIHVQGQGSAVPPPVLTFTSCGLPPKLLLNLETAGYDFPTPIQ 137 >At4g33830.1 68417.m04801 glycosyl hydrolase family 10 protein xylan endohydrolase isoenzyme X-I, Hordeum vulgare,PID:g1813595 Length = 544 Score = 28.3 bits (60), Expect = 1.4 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 4/39 (10%) Frame = +1 Query: 112 DSLSLQPFNKDFYNPH-KSVLDRS---PYEVEDYRNKHE 216 DS+SLQPF +D +N H + +D S P + NK E Sbjct: 140 DSVSLQPFTQDEWNAHQEQSIDNSRKGPVRIRVVNNKGE 178 >At1g51380.1 68414.m05780 eukaryotic translation initiation factor 4A, putative / eIF-4A, putative Length = 392 Score = 27.9 bits (59), Expect = 1.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 247 PIEHFEEANFPDYVCQAIKSMGYKDPTPIQ 336 PI+ F++ D V + + GYK P+ IQ Sbjct: 20 PIKSFDDMGMNDKVLRGVYDYGYKKPSEIQ 49 >At4g31540.1 68417.m04478 exocyst subunit EXO70 family protein (EXO70-G1) tomato leucine zipper-containing protein - Lycopersicon esculentum, PIR2:S21495; contains Pfam domain PF03081: Exo70 exocyst complex subunit; Length = 687 Score = 27.5 bits (58), Expect = 2.4 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +2 Query: 65 PREISLVGKICDALIGIRCRSNHLTKIFIILINQSW 172 PR +S V C+ LIG + +S LT+ ++LI++SW Sbjct: 430 PRLVSFVTDYCNKLIGDKYKST-LTQ--VLLIHKSW 462 >At2g26160.1 68415.m03139 F-box family protein contains F-box domain Pfam:PF00646 Length = 359 Score = 26.6 bits (56), Expect = 4.2 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +1 Query: 124 LQPFNKDFYNPHKSVLDRSPYEVEDYRNKHEVTV 225 L PF + P + LD +EV + R +E+ + Sbjct: 97 LSPFFRQLLTPSQQTLDLLKFEVSEIRQSYEIHI 130 >At3g08820.1 68416.m01024 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 685 Score = 26.2 bits (55), Expect = 5.6 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 53 VALAPREISLVGKICDALIGIRCRSNHLTKIFIILIN 163 + P S V +I LI + C NHL +I + LIN Sbjct: 3 IVTVPSATSKVQQI-KTLISVACTVNHLKQIHVSLIN 38 >At2g39710.1 68415.m04872 aspartyl protease family protein contains profile Pfam PF00026: Eukaryotic aspartyl protease; contains Prosite PS00141: Eukaryotic and viral aspartyl proteases active site.; Length = 442 Score = 25.8 bits (54), Expect = 7.4 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 193 LLHMVTYPRLIYEDYKNLC*MVGATANPN 107 +L +V P +++ +LC VG+T PN Sbjct: 320 VLRLVDDPDFVFQGTMDLCYKVGSTTRPN 348 >At2g01830.3 68415.m00115 histidine kinase (AHK4) (WOL) identical to histidine kinase AHK4 [Arabidopsis thaliana] gi|13537200|dbj|BAB40776; contains Pfam profiles PF03924: CHASE domain, PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00512: His Kinase A (phosphoacceptor) domain, PF00072: Response regulator receiver domain Length = 1057 Score = 25.8 bits (54), Expect = 7.4 Identities = 16/64 (25%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +1 Query: 148 YNPHKSVLDRSPYEVEDYRNKHE-VTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDP 324 Y+ + S +D+ + R E +SGV + +FE F IK+M +P Sbjct: 172 YHKNPSAIDQETFAEYTARTAFERPLLSGVAYAEKVVNFEREMFERQHNWVIKTMDRGEP 231 Query: 325 TPIQ 336 +P++ Sbjct: 232 SPVR 235 >At2g01830.2 68415.m00116 histidine kinase (AHK4) (WOL) identical to histidine kinase AHK4 [Arabidopsis thaliana] gi|13537200|dbj|BAB40776; contains Pfam profiles PF03924: CHASE domain, PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00512: His Kinase A (phosphoacceptor) domain, PF00072: Response regulator receiver domain Length = 1080 Score = 25.8 bits (54), Expect = 7.4 Identities = 16/64 (25%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +1 Query: 148 YNPHKSVLDRSPYEVEDYRNKHE-VTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDP 324 Y+ + S +D+ + R E +SGV + +FE F IK+M +P Sbjct: 195 YHKNPSAIDQETFAEYTARTAFERPLLSGVAYAEKVVNFEREMFERQHNWVIKTMDRGEP 254 Query: 325 TPIQ 336 +P++ Sbjct: 255 SPVR 258 >At2g01830.1 68415.m00114 histidine kinase (AHK4) (WOL) identical to histidine kinase AHK4 [Arabidopsis thaliana] gi|13537200|dbj|BAB40776; contains Pfam profiles PF03924: CHASE domain, PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00512: His Kinase A (phosphoacceptor) domain, PF00072: Response regulator receiver domain Length = 1057 Score = 25.8 bits (54), Expect = 7.4 Identities = 16/64 (25%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +1 Query: 148 YNPHKSVLDRSPYEVEDYRNKHE-VTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDP 324 Y+ + S +D+ + R E +SGV + +FE F IK+M +P Sbjct: 172 YHKNPSAIDQETFAEYTARTAFERPLLSGVAYAEKVVNFEREMFERQHNWVIKTMDRGEP 231 Query: 325 TPIQ 336 +P++ Sbjct: 232 SPVR 235 >At1g12770.1 68414.m01482 DEAD/DEAH box helicase family protein / pentatricopeptide (PPR) repeat-containing protein contains Pfam profiles: PF00271 helicase conserved C-terminal domain, PF01535 PPR repeat, PF00270: DEAD/DEAH box helicase Length = 1145 Score = 25.8 bits (54), Expect = 7.4 Identities = 11/38 (28%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +1 Query: 235 EVPNPI---EHFEEANFPDYVCQAIKSMGYKDPTPIQA 339 E+ +P+ + FEE PD + +++ G+ PT +Q+ Sbjct: 101 EIVSPLFSAKSFEELGLPDSLLDSLEREGFSVPTDVQS 138 >At5g50220.1 68418.m06220 F-box family protein contains F-box domain Pfam:PF00646 Length = 357 Score = 25.4 bits (53), Expect = 9.7 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +1 Query: 118 LSLQPFNKDFYNPHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEH 258 LS Q +Y P ++ + R E YR KH V + VP+ +E+ Sbjct: 309 LSCQTLYVYYYGPKRNSMRRVEVEGTKYRRKHLVHI--CPVPDHVEN 353 >At4g36100.1 68417.m05138 expressed protein contains Pfam domain, PF04859: Plant protein of unknown function (DUF641) Length = 236 Score = 25.4 bits (53), Expect = 9.7 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +1 Query: 178 SPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVC 291 +PY+ E + +V +S ++ + ++HF N P VC Sbjct: 38 TPYDPEKIQAADKVVISELKNLSEMKHFYRENNPKPVC 75 >At4g34080.1 68417.m04835 expressed protein contains Pfam profile PF04859: Plant protein of unknown function (DUF641 Length = 331 Score = 25.4 bits (53), Expect = 9.7 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +1 Query: 178 SPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVC 291 +PY+ E + +V +S ++ + ++HF N P VC Sbjct: 38 TPYDPEKIQAADKVVISELKNLSEMKHFYRENNPKPVC 75 >At3g05790.1 68416.m00650 Lon protease, putative similar to Lon protease homolog 2 SP:P93655 Length = 942 Score = 25.4 bits (53), Expect = 9.7 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 143 SLLNGWSDSESQLGRRIF 90 +LL GW+ S +LGRR F Sbjct: 35 TLLTGWNRSSYELGRRSF 52 >At2g45260.1 68415.m05634 expressed protein contains Pfam profile PF04859: Plant protein of unknown function (DUF641 Length = 425 Score = 25.4 bits (53), Expect = 9.7 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +1 Query: 178 SPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVC 291 +PY+ E + +V +S ++ + ++HF N P VC Sbjct: 62 TPYDPEKIQAADKVVISELKNLSEMKHFYRENNPKPVC 99 >At1g77360.1 68414.m09009 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 481 Score = 25.4 bits (53), Expect = 9.7 Identities = 14/52 (26%), Positives = 29/52 (55%) Frame = +2 Query: 92 ICDALIGIRCRSNHLTKIFIILINQSWIGHHMK*RTIETNTKSLLVELKYLI 247 + ++LIG C++N + ++ +L MK + + N+KS + L++LI Sbjct: 308 VFNSLIGAFCKANRMKNVYRVL-------KEMKSKGVTPNSKSCNIILRHLI 352 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.134 0.423 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,541,918 Number of Sequences: 28952 Number of extensions: 119768 Number of successful extensions: 339 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 338 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 399440640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -