BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_C10 (395 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0726 + 5319809-5319839,5319918-5319976,5320859-5320927,532... 56 1e-08 11_04_0089 + 13383779-13384018,13384962-13385225 27 4.1 >06_01_0726 + 5319809-5319839,5319918-5319976,5320859-5320927, 5321009-5321071,5321360-5321419 Length = 93 Score = 55.6 bits (128), Expect = 1e-08 Identities = 21/39 (53%), Positives = 30/39 (76%) Frame = +1 Query: 10 LYVNQTFAPSPDQIVKNLYECFGTDGKLVLHYCKSQAWG 126 LYVN F+P+PD+++ +LY FG DG+LV++Y S AWG Sbjct: 55 LYVNSAFSPNPDELIIDLYNNFGIDGQLVVNYASSMAWG 93 >11_04_0089 + 13383779-13384018,13384962-13385225 Length = 167 Score = 27.5 bits (58), Expect = 4.1 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +1 Query: 19 NQTFAPSPDQIVKNLYECFGTDGKLVLHYCKSQAW 123 N F PSP++ K C G + + V ++ S W Sbjct: 95 NSPFIPSPEEYAKAAVRCIGYEPRCVPYWRHSIQW 129 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,181,110 Number of Sequences: 37544 Number of extensions: 123496 Number of successful extensions: 225 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 224 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 225 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 684860244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -