Samia BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0001_C10
         (395 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_12949| Best HMM Match : T_Ag_DNA_bind (HMM E-Value=2.4)             31   0.26 

>SB_12949| Best HMM Match : T_Ag_DNA_bind (HMM E-Value=2.4)
          Length = 196

 Score = 31.5 bits (68), Expect = 0.26
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 6/64 (9%)
 Frame = -3

Query: 363 NFSTCRGLASKHSFIYIISKSLELISLHYRYIS------FFKDIFKLHDLI*VSISKLLK 202
           NF TC    ++ +   I ++      LHYRY S      F    FK+ D   VS+  LLK
Sbjct: 13  NFLTCYLFGTRENHALITTRRAVKTGLHYRYYSNESKFHFTGTTFKMADKHEVSVVGLLK 72

Query: 201 HLDY 190
            +D+
Sbjct: 73  DVDF 76


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,699,330
Number of Sequences: 59808
Number of extensions: 142630
Number of successful extensions: 276
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 266
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 276
length of database: 16,821,457
effective HSP length: 75
effective length of database: 12,335,857
effective search space used: 690807992
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)