BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_C10 (395 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12949| Best HMM Match : T_Ag_DNA_bind (HMM E-Value=2.4) 31 0.26 >SB_12949| Best HMM Match : T_Ag_DNA_bind (HMM E-Value=2.4) Length = 196 Score = 31.5 bits (68), Expect = 0.26 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 6/64 (9%) Frame = -3 Query: 363 NFSTCRGLASKHSFIYIISKSLELISLHYRYIS------FFKDIFKLHDLI*VSISKLLK 202 NF TC ++ + I ++ LHYRY S F FK+ D VS+ LLK Sbjct: 13 NFLTCYLFGTRENHALITTRRAVKTGLHYRYYSNESKFHFTGTTFKMADKHEVSVVGLLK 72 Query: 201 HLDY 190 +D+ Sbjct: 73 DVDF 76 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,699,330 Number of Sequences: 59808 Number of extensions: 142630 Number of successful extensions: 276 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 276 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 690807992 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -