BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_C10 (395 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC012266-1|AAH12266.2| 187|Homo sapiens ATG12 autophagy related... 80 2e-15 AB017507-1|BAA36493.1| 140|Homo sapiens Apg12 protein. 80 2e-15 >BC012266-1|AAH12266.2| 187|Homo sapiens ATG12 autophagy related 12 homolog (S. cerevisiae) protein. Length = 187 Score = 80.2 bits (189), Expect = 2e-15 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +1 Query: 10 LYVNQTFAPSPDQIVKNLYECFGTDGKLVLHYCKSQAWG 126 +YVNQ+FAPSPDQ V LYECFG+DGKLVLHYCKSQAWG Sbjct: 149 IYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG 187 >AB017507-1|BAA36493.1| 140|Homo sapiens Apg12 protein. Length = 140 Score = 80.2 bits (189), Expect = 2e-15 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +1 Query: 10 LYVNQTFAPSPDQIVKNLYECFGTDGKLVLHYCKSQAWG 126 +YVNQ+FAPSPDQ V LYECFG+DGKLVLHYCKSQAWG Sbjct: 102 IYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG 140 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 45,325,408 Number of Sequences: 237096 Number of extensions: 707320 Number of successful extensions: 1232 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1223 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1224 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2813442310 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -