BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_C10 (395 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 3.9 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 3.9 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 21 3.9 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 21 3.9 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 21 3.9 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 21 3.9 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 3.9 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 3.9 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 5.1 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 21 6.8 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 21 6.8 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 21 6.8 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 21 6.8 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 20 9.0 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 20 9.0 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 20 9.0 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 20 9.0 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 3.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 Query: 40 PDQIVKNLYECFGTDGKLVLHYCKSQ 117 P Q+VKNL+ T K YC S+ Sbjct: 197 PVQVVKNLHLPRFTLEKFFTDYCNSK 222 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 3.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 Query: 40 PDQIVKNLYECFGTDGKLVLHYCKSQ 117 P Q+VKNL+ T K YC S+ Sbjct: 197 PVQVVKNLHLPRFTLEKFFTDYCNSK 222 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 3.9 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 125 ADYQKHNNVNWNN*LYYQL 181 ++Y +NN N+NN Y +L Sbjct: 92 SNYNNYNNNNYNNNNYKKL 110 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 3.9 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 125 ADYQKHNNVNWNN*LYYQL 181 ++Y +NN N+NN Y +L Sbjct: 92 SNYNNYNNNNYNNNNYKKL 110 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 3.9 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 125 ADYQKHNNVNWNN*LYYQL 181 ++Y +NN N+NN Y +L Sbjct: 92 SNYNNYNNNNYNNNNYKKL 110 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 3.9 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 125 ADYQKHNNVNWNN*LYYQL 181 ++Y +NN N+NN Y +L Sbjct: 92 SNYNNYNNNNYNNNNYKKL 110 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 3.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 140 HNNVNWNN*LYYQLL 184 +NN N+N LYY ++ Sbjct: 103 YNNNNYNKKLYYNII 117 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 3.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 140 HNNVNWNN*LYYQLL 184 +NN N+N LYY ++ Sbjct: 103 YNNNNYNKKLYYNII 117 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.0 bits (42), Expect = 5.1 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +2 Query: 83 MESLCCIIAKAKRGADYQKHNNVNWNN*LYYQL 181 M+SL ++ G ++N W N ++YQ+ Sbjct: 1 MKSLVVVVLLLAVGLGAGQNNKGWWKNAIFYQV 33 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 6.8 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 140 HNNVNWNN*LYYQL 181 +NN N+N LYY + Sbjct: 99 YNNNNYNKKLYYNI 112 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 6.8 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 140 HNNVNWNN*LYYQL 181 +NN N+N LYY + Sbjct: 99 YNNNNYNKKLYYNI 112 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 6.8 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 140 HNNVNWNN*LYYQL 181 +NN N+N LYY + Sbjct: 99 YNNNNYNKKLYYNI 112 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 6.8 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 140 HNNVNWNN*LYYQL 181 +NN N+N LYY + Sbjct: 99 YNNNNYNKKLYYNI 112 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 20.2 bits (40), Expect = 9.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 140 HNNVNWNN*LYYQL 181 +NN N+N LYY + Sbjct: 97 NNNNNYNKKLYYNI 110 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.2 bits (40), Expect = 9.0 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 140 HNNVNWNN*LYYQ 178 +NN N+N LYY+ Sbjct: 106 YNNNNYNKKLYYK 118 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.2 bits (40), Expect = 9.0 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = +2 Query: 101 IIAKAKRGADYQKHNNVNWNN*LYYQLL 184 II+ + +N N+N LYY ++ Sbjct: 314 IISSLSNKTIHNNNNYKNYNKKLYYNII 341 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 20.2 bits (40), Expect = 9.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 140 HNNVNWNN*LYYQL 181 +NN N+N LYY + Sbjct: 335 NNNNNYNKKLYYNI 348 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,278 Number of Sequences: 438 Number of extensions: 1732 Number of successful extensions: 17 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9761793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -