BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_C09 (330 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g54450.1 68416.m06024 proton-dependent oligopeptide transport... 30 0.33 At3g62010.1 68416.m06964 expressed protein 29 1.00 At1g22410.1 68414.m02802 2-dehydro-3-deoxyphosphoheptonate aldol... 29 1.00 At3g21430.1 68416.m02704 expressed protein 28 1.3 At1g06460.1 68414.m00684 31.2 kDa small heat shock family protei... 28 1.3 At3g19830.1 68416.m02512 C2 domain-containing protein low simila... 28 1.7 At1g44910.1 68414.m05146 FF domain-containing protein / WW domai... 27 2.3 At4g30350.1 68417.m04313 heat shock protein-related contains sim... 27 3.0 At1g08840.1 68414.m00984 DNA replication helicase, putative simi... 27 3.0 At3g55520.1 68416.m06165 immunophilin, putative / FKBP-type pept... 27 4.0 At2g17010.1 68415.m01961 mechanosensitive ion channel domain-con... 27 4.0 At1g80040.2 68414.m09370 expressed protein 27 4.0 At1g80040.1 68414.m09369 expressed protein 27 4.0 At1g67420.1 68414.m07674 24 kDa vacuolar protein, putative simil... 26 5.3 At1g22570.1 68414.m02818 proton-dependent oligopeptide transport... 26 5.3 At1g22550.1 68414.m02816 proton-dependent oligopeptide transport... 26 5.3 At1g09190.1 68414.m01026 pentatricopeptide (PPR) repeat-containi... 26 5.3 At5g06510.2 68418.m00733 CCAAT-binding transcription factor (CBF... 26 7.0 At5g06510.1 68418.m00732 CCAAT-binding transcription factor (CBF... 26 7.0 At3g17740.1 68416.m02264 expressed protein 26 7.0 At2g21950.1 68415.m02608 SKP1 interacting partner 6 (SKIP6) iden... 26 7.0 At2g18900.1 68415.m02205 transducin family protein / WD-40 repea... 26 7.0 At4g18760.1 68417.m02772 leucine-rich repeat family protein cont... 25 9.3 At3g26780.1 68416.m03350 phosphoglycerate/bisphosphoglycerate mu... 25 9.3 At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical ... 25 9.3 At1g07650.1 68414.m00821 leucine-rich repeat transmembrane prote... 25 9.3 >At3g54450.1 68416.m06024 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 488 Score = 30.3 bits (65), Expect = 0.33 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +1 Query: 85 LVICSLLRASRYGLATRHGVCSNS*YLETIPTCLLWFVP 201 +VIC L+ A R +A HG+ + E +P LW +P Sbjct: 336 MVICGLVEAKRLKVARDHGLIDSP--KEVVPMSSLWLLP 372 >At3g62010.1 68416.m06964 expressed protein Length = 1254 Score = 28.7 bits (61), Expect = 1.00 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = +3 Query: 156 LISGDYPDLLTLVR--TYRPRSINPLDEMPAKLSRCGHQRTAHFHVRRQTLDLPRT 317 L GDY D+L+L+R ++ P+S + +D + + GH R + ++ LP T Sbjct: 1139 LSMGDYRDILSLIRVLSHGPQSKSDVDGIVELCAGAGHLREDIVYYSKELNKLPIT 1194 >At1g22410.1 68414.m02802 2-dehydro-3-deoxyphosphoheptonate aldolase, putative / 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase, putative / DAHP synthetase, putative similar to 3-deoxy-D-arabino-heptulosonate 7-phosphate GI:170224 from [Nicotiana tabacum], SP|P21357 from Solanum tuberosum; contains Pfam Class-II DAHP synthetase family domain PF01474 Length = 527 Score = 28.7 bits (61), Expect = 1.00 Identities = 20/60 (33%), Positives = 24/60 (40%), Gaps = 3/60 (5%) Frame = +3 Query: 21 SLSQYIPSQVTGYAASGPTSWTSYLFSPASIPVWSGD---ASWSLLKQLISGDYPDLLTL 191 S Q P +AS T+ + L P + V G SW K L DYPDL L Sbjct: 38 SAVQTDPKTPAASSASAATTTPATLTKPVGVNVGKGKWAPESWRTKKALQQPDYPDLAAL 97 >At3g21430.1 68416.m02704 expressed protein Length = 961 Score = 28.3 bits (60), Expect = 1.3 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +3 Query: 159 ISGDYPDL-LTLVRTYRPRSINPLDEMPAKLSRCGHQRTAHFHVR 290 I D P+L + V+ +NPL+ MPA L+R H +++H++ Sbjct: 557 IQFDNPELGVEFVKDTECMPLNPLENMPASLAR--HYAFSNYHIQ 599 >At1g06460.1 68414.m00684 31.2 kDa small heat shock family protein / hsp20 family protein contains Pfam profile: PF00011 Hsp20/alpha crystallin family Length = 285 Score = 28.3 bits (60), Expect = 1.3 Identities = 16/63 (25%), Positives = 29/63 (46%) Frame = +3 Query: 27 SQYIPSQVTGYAASGPTSWTSYLFSPASIPVWSGDASWSLLKQLISGDYPDLLTLVRTYR 206 +++ ++ TG+ +S P + PA ++ S +L K+ D P L L + Sbjct: 126 TKFSATKTTGFDSSSPAYAAPHFSKPAKEDIFFPSLSPNLQKERPKLDLPKLANLGTVWS 185 Query: 207 PRS 215 PRS Sbjct: 186 PRS 188 >At3g19830.1 68416.m02512 C2 domain-containing protein low similarity to GLUT4 vesicle protein [Rattus norvegicus] GI:4193489; contains Pfam profile PF00168: C2 domain Length = 666 Score = 27.9 bits (59), Expect = 1.7 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = +3 Query: 15 FSSLSQYIPSQVTGYAASGPTSWTSYLFSPASIPVWSGDASWSLLKQLISGDYPDL 182 F + +P + + G W P S P W G ASW+ L +L++ D P L Sbjct: 296 FGIIPVVVPVGIRDFDIDGEL-WVKLRLIP-SAP-WVGAASWAFLTKLLTEDLPRL 348 >At1g44910.1 68414.m05146 FF domain-containing protein / WW domain-containing protein contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 946 Score = 27.5 bits (58), Expect = 2.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 48 VTGYAASGPTSWTSYLFSPASIP 116 +TG+A SGP + Y F P+S P Sbjct: 93 MTGFATSGPPFSSPYTFVPSSYP 115 >At4g30350.1 68417.m04313 heat shock protein-related contains similarity to heat shock protein 101 [Triticum aestivum] gi|6013196|gb|AAF01280 Length = 924 Score = 27.1 bits (57), Expect = 3.0 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 177 DLLTLVRTYRPRSINPLDEMPAKLSRCGHQRTAHFHV 287 DL+T+ +T P + L++ A+ +R H T HV Sbjct: 4 DLITIQQTLTPEAATVLNQSIAEATRRNHGHTTPLHV 40 >At1g08840.1 68414.m00984 DNA replication helicase, putative similar to helicase [Xenopus laevis] gi|18845092|gb|AAL79550 Length = 1296 Score = 27.1 bits (57), Expect = 3.0 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 47 GHRLCCFWTYIMD*LFVLSCEHPGMVW-RRVMEFAQTADIWRLSRLAYFGSYLQTTIDQP 223 G RLCC + D VLS W ++V+E +T L F + Q I+ P Sbjct: 1102 GDRLCCGSAEVADATLVLSTSSSTSPWLKKVLEPTRTVVFVNTDMLRAFEARDQNAINNP 1161 >At3g55520.1 68416.m06165 immunophilin, putative / FKBP-type peptidyl-prolyl cis-trans isomerase, putative POSSIBLE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE) (EC 5.2.1.8) (PPIASE) (ROTAMASE) SP:P30416(Mouse);P59 PROTEIN (HSP BINDING IMMUNOPHILIN), rabbit, SWISSPROT:P27124:FKB4_RABBIT Length = 190 Score = 26.6 bits (56), Expect = 4.0 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 159 ISGDYPDLLTLVRTYRPRSINPLDEMP 239 +SGD L +VR+ +P +I+P D++P Sbjct: 7 LSGDGGVLKKIVRSAKPDAISPSDDLP 33 >At2g17010.1 68415.m01961 mechanosensitive ion channel domain-containing protein / MS ion channel domain-containing protein contains Pfam profile PF00924: Mechanosensitive ion channel Length = 779 Score = 26.6 bits (56), Expect = 4.0 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 166 PDISCLSKLHDASPDHTGMLAGENK 92 P L LHD PDH+GM+ + K Sbjct: 25 PSPEHLPILHDHHPDHSGMVVDDQK 49 >At1g80040.2 68414.m09370 expressed protein Length = 180 Score = 26.6 bits (56), Expect = 4.0 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +3 Query: 63 ASGPTSWTSYLFSPASIPVWSGDASWSLLKQLISGDYPDLLTLVR 197 +S P+S FSP++ P+WS S SL + + + +L LV+ Sbjct: 17 SSPPSSKRFRCFSPSNSPIWSSPPSSSLDQLHSAFPHIELTVLVK 61 >At1g80040.1 68414.m09369 expressed protein Length = 248 Score = 26.6 bits (56), Expect = 4.0 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +3 Query: 63 ASGPTSWTSYLFSPASIPVWSGDASWSLLKQLISGDYPDLLTLVR 197 +S P+S FSP++ P+WS S SL + + + +L LV+ Sbjct: 17 SSPPSSKRFRCFSPSNSPIWSSPPSSSLDQLHSAFPHIELTVLVK 61 >At1g67420.1 68414.m07674 24 kDa vacuolar protein, putative similar to 24 kDa vacuolar protein VP24 [Ipomoea batatas] gi|5821406|dbj|BAA83809 Length = 873 Score = 26.2 bits (55), Expect = 5.3 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +3 Query: 66 SGPTSWTSYLFSPASI 113 SGP SW SY++S A++ Sbjct: 239 SGPGSWPSYVYSQAAV 254 >At1g22570.1 68414.m02818 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 565 Score = 26.2 bits (55), Expect = 5.3 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +1 Query: 85 LVICSLLRASRYGLATRHGVCSNS*YLETIPTCLLWFVP 201 +++ +L+ + R +A HG+ T+P + WFVP Sbjct: 423 MMLAALVESKRLKIAREHGLVDKPDV--TVPMSIWWFVP 459 >At1g22550.1 68414.m02816 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 564 Score = 26.2 bits (55), Expect = 5.3 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 85 LVICSLLRASRYGLATRHGVCSNS*YLETIPTCLLWFVP 201 +V+ +L+ R A HG+ TIP + WFVP Sbjct: 419 MVVAALVEMKRLETAKEHGLVDRPD--ATIPMSIWWFVP 455 >At1g09190.1 68414.m01026 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 999 Score = 26.2 bits (55), Expect = 5.3 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +3 Query: 162 SGDYPDLLTLVRTYRPRSINPLDEMPAKLSRCGHQRTA 275 SGD L L + RSI + M + LS+CG R A Sbjct: 696 SGDVERGLHLFKQMSERSIVSWNSMISSLSKCGRDREA 733 >At5g06510.2 68418.m00733 CCAAT-binding transcription factor (CBF-B/NF-YA) family protein contains Pfam profile: PF02045 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B Length = 269 Score = 25.8 bits (54), Expect = 7.0 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +3 Query: 84 TSYLFSPASIPVWSGDASWSLLKQLISGDYPDLLTLVR 197 T L SP P W+ S L + +SG+ D T V+ Sbjct: 3 TEELLSPPQTPWWNAFGSQPLTTESLSGEASDSFTGVK 40 >At5g06510.1 68418.m00732 CCAAT-binding transcription factor (CBF-B/NF-YA) family protein contains Pfam profile: PF02045 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B Length = 269 Score = 25.8 bits (54), Expect = 7.0 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +3 Query: 84 TSYLFSPASIPVWSGDASWSLLKQLISGDYPDLLTLVR 197 T L SP P W+ S L + +SG+ D T V+ Sbjct: 3 TEELLSPPQTPWWNAFGSQPLTTESLSGEASDSFTGVK 40 >At3g17740.1 68416.m02264 expressed protein Length = 1149 Score = 25.8 bits (54), Expect = 7.0 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -2 Query: 254 ARQFSRHFVKWVDRSWSVGTNQSKQVGIVSRYQLFEQ 144 ARQ R +K + +WS G + +V LFE+ Sbjct: 895 ARQGFREKLKKIQSTWSHGVTDDQSAALVCSAALFEE 931 >At2g21950.1 68415.m02608 SKP1 interacting partner 6 (SKIP6) identical to SKP1 interacting partner 6 GI:10716957 from [Arabidopsis thaliana] Length = 372 Score = 25.8 bits (54), Expect = 7.0 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 99 SPAS-IPVWSGDASWSLLKQLISGDYPDLLTLVRTYRPRSINPL 227 SPA IP+ S D + S L ++ YP L + +T+R +PL Sbjct: 16 SPAQLIPLLSEDVALSCLARVPRCHYPILSLVSKTFRSLPTSPL 59 >At2g18900.1 68415.m02205 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); related to LACK protective antigen (GI:13625467) [Leishmania donovani] Length = 804 Score = 25.8 bits (54), Expect = 7.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -1 Query: 324 AALSGEGQVFAVERENVLSV 265 AA SG+G V AV ENV+++ Sbjct: 543 AAFSGDGTVMAVAAENVITL 562 >At4g18760.1 68417.m02772 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 Length = 431 Score = 25.4 bits (53), Expect = 9.3 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 102 PASIPVWSGDASWSLLKQLISGDYPD 179 P SI + S S +L K ISGD PD Sbjct: 229 PTSITLLSNLKSLNLSKNTISGDIPD 254 >At3g26780.1 68416.m03350 phosphoglycerate/bisphosphoglycerate mutase family protein similar to X4 protein GI:21386798, Y4 protein GI:21386800 from [Silene dioica]; contains Pfam profiles PF00300: phosphoglycerate mutase family, PF01535: PPR repeat Length = 1053 Score = 25.4 bits (53), Expect = 9.3 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = -2 Query: 305 VKCLPSNVKMCCPLMTTARQFSRHFVKWVDRSWSVGTNQSKQVGIVSRYQLFEQ 144 +KCL + + C P+MT V + SW G Q K++ + +LF++ Sbjct: 349 IKCLLTGILGCSPVMTHKICVEDSSVTVLQHSWRNGW-QIKRMNDTAHLRLFKK 401 >At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1368 Score = 25.4 bits (53), Expect = 9.3 Identities = 17/61 (27%), Positives = 29/61 (47%) Frame = +1 Query: 52 PVMLLLDLHHGLVICSLLRASRYGLATRHGVCSNS*YLETIPTCLLWFVPTDHDRSTHLT 231 P+M LLD+ VIC++L+ + N+ + IP ++ F + DRS + Sbjct: 621 PLMDLLDIPKSRVICAVLQLINEIIKDNTDFQENACLVGLIPV-VMSFAGPERDRSREIR 679 Query: 232 K 234 K Sbjct: 680 K 680 >At1g07650.1 68414.m00821 leucine-rich repeat transmembrane protein kinase, putative similar to GB:AAC50043 from [Arabidopsis thaliana] (Plant Mol. Biol. 37 (4), 587-596 (1998)) Length = 1014 Score = 25.4 bits (53), Expect = 9.3 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 178 TCLLWFVPTDHDRSTHLTKCLLNC 249 TC L +P H + HL K +NC Sbjct: 396 TCFLQRMPCVHPKRYHLYKLYINC 419 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,895,641 Number of Sequences: 28952 Number of extensions: 159111 Number of successful extensions: 425 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 425 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 380568784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -