BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_C07 (237 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ416109-1|CAC94781.1| 234|Anopheles gambiae PROSAg25 protein p... 107 4e-26 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 25 0.49 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 1.5 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 23 2.0 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 22 3.5 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 22 3.5 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 22 3.5 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 21 4.6 AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthe... 21 6.0 AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A prot... 21 6.0 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 21 8.0 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 21 8.0 AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 prot... 21 8.0 AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A prot... 21 8.0 AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A prot... 21 8.0 AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A prot... 21 8.0 AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A prot... 21 8.0 AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A prot... 21 8.0 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 21 8.0 AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 prot... 21 8.0 >AJ416109-1|CAC94781.1| 234|Anopheles gambiae PROSAg25 protein protein. Length = 234 Score = 107 bits (258), Expect = 4e-26 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = +3 Query: 9 EDLELDDAVHTAILTLKEGFEGQMTADNIEVGICDASGFRRLEPAHVKDYLANIP 173 EDLELDDAVHTAILTLKEGFEGQM ADNIEVGICDA+GFRRL+P+ V+DYLANIP Sbjct: 180 EDLELDDAVHTAILTLKEGFEGQMNADNIEVGICDANGFRRLDPSDVQDYLANIP 234 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 24.6 bits (51), Expect = 0.49 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 153 PSREPVPVSGTRLRHKYP 100 P++ P + TRLRH YP Sbjct: 132 PAKRPAFDTDTRLRHSYP 149 Score = 22.6 bits (46), Expect = 2.0 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 87 PPSSDPRTPPSASGSPCGQHH 25 PPS+ +P S S P G H Sbjct: 110 PPSAASESPGSVSSQPSGPIH 130 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.0 bits (47), Expect = 1.5 Identities = 14/54 (25%), Positives = 23/54 (42%) Frame = -1 Query: 168 Y*RDSPSREPVPVSGTRLRHKYPLRYYPPSSDPRTPPSASGSPCGQHHPVPDPP 7 Y + P P P + ++ + P PP +D + PS+ P +P PP Sbjct: 634 YQQQQPPVVPPPRTNSQSQASEPTPALPPRADRDSKPSSRDRP----KDLPPPP 683 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 22.6 bits (46), Expect = 2.0 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -1 Query: 87 PPSSDPRTPPSASGSPCGQHHPVPDPP 7 P S PR PS SP G+ PP Sbjct: 430 PTPSVPRPLPSQEASPSGEQPGRMGPP 456 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 21.8 bits (44), Expect = 3.5 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -1 Query: 153 PSREPVPVSGTRLRHKYPLRYYPPSSDPRTPPSA 52 P +P PV R RH P + + TPP++ Sbjct: 195 PYAQP-PVGPLRFRHPRPAEKWTGVLNTTTPPNS 227 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 21.8 bits (44), Expect = 3.5 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -1 Query: 153 PSREPVPVSGTRLRHKYPLRYYPPSSDPRTPPSA 52 P +P PV R RH P + + TPP++ Sbjct: 195 PYAQP-PVGPLRFRHPRPAEKWTGVLNTTTPPNS 227 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 21.8 bits (44), Expect = 3.5 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -1 Query: 153 PSREPVPVSGTRLRHKYPLRYYPPSSDPRTPPSA 52 P +P PV R RH P + + TPP++ Sbjct: 81 PYAQP-PVGPLRFRHPRPAEKWTGVLNTTTPPNS 113 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 21.4 bits (43), Expect = 4.6 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -1 Query: 36 GQHHPVPDPP 7 G+ HP P PP Sbjct: 1122 GRRHPTPSPP 1131 >AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 94 HMDVVRRQLTMK 105 >AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 94 HMDVVRRQLTMK 105 >AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 95 HMDVVRRQLTMK 106 >AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 94 HMDVVRRQLTMK 105 >AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 94 HMDVVRRQLTMK 105 >AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 130 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 78 HMDVVRRQLTMK 89 >AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 101 HFDIIRRHLTLE 66 H D++RR LT++ Sbjct: 108 HMDVVRRQLTMK 119 >AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -1 Query: 87 PPSSDPRTPP 58 PP DP+ PP Sbjct: 22 PPQDDPKQPP 31 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 20.6 bits (41), Expect = 8.0 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -2 Query: 140 RFQSPEPACVT 108 RFQ+P+ C+T Sbjct: 121 RFQTPDVVCIT 131 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 20.6 bits (41), Expect = 8.0 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -1 Query: 36 GQHHPVPDPP 7 G+ P+PDPP Sbjct: 694 GEEAPLPDPP 703 >AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 protein. Length = 153 Score = 20.6 bits (41), Expect = 8.0 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = -1 Query: 87 PPSSDPRTPPSASGSP 40 PP DP PP P Sbjct: 22 PPQDDPEQPPVLLAHP 37 >AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 20.6 bits (41), Expect = 8.0 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = -1 Query: 87 PPSSDPRTPPSASGSP 40 PP DP PP P Sbjct: 22 PPQDDPEQPPVLLAHP 37 >AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 20.6 bits (41), Expect = 8.0 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = -1 Query: 87 PPSSDPRTPPSASGSP 40 PP DP PP P Sbjct: 22 PPQDDPEQPPVLLAHP 37 >AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 20.6 bits (41), Expect = 8.0 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = -1 Query: 87 PPSSDPRTPPSASGSP 40 PP DP PP P Sbjct: 22 PPQDDPEQPPVLLAHP 37 >AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 20.6 bits (41), Expect = 8.0 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = -1 Query: 87 PPSSDPRTPPSASGSP 40 PP DP PP P Sbjct: 22 PPQDDPEQPPVLLAHP 37 >AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 20.6 bits (41), Expect = 8.0 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = -1 Query: 87 PPSSDPRTPPSASGSP 40 PP DP PP P Sbjct: 22 PPQDDPEQPPVLLAHP 37 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 20.6 bits (41), Expect = 8.0 Identities = 8/28 (28%), Positives = 12/28 (42%) Frame = -1 Query: 87 PPSSDPRTPPSASGSPCGQHHPVPDPPS 4 PP+ PP + Q P+P P+ Sbjct: 920 PPTHRLEQPPQVVAAAPTQQQPLPPAPA 947 >AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 protein. Length = 153 Score = 20.6 bits (41), Expect = 8.0 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = -1 Query: 87 PPSSDPRTPPSASGSP 40 PP DP PP P Sbjct: 22 PPQDDPEQPPVLLAHP 37 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 239,654 Number of Sequences: 2352 Number of extensions: 4094 Number of successful extensions: 59 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 563,979 effective HSP length: 52 effective length of database: 441,675 effective search space used: 11483550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -