SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0001_C06
         (449 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ372925-1|ABD17350.1|  596|Tribolium castaneum telomerase rever...    24   0.76 
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    22   3.1  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    21   7.1  
AM292362-1|CAL23174.2|  398|Tribolium castaneum gustatory recept...    20   9.4  

>DQ372925-1|ABD17350.1|  596|Tribolium castaneum telomerase reverse
           transcriptase protein.
          Length = 596

 Score = 23.8 bits (49), Expect = 0.76
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = -2

Query: 55  GSLRRCWSKYTQ 20
           GSL  CWS++TQ
Sbjct: 228 GSLYTCWSEFTQ 239


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 21.8 bits (44), Expect = 3.1
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = -1

Query: 125 QCTRSRSILVSILSTLSQLLFGQGILTSLLVKVYTI 18
           +CT S   L S+ +  S      GIL SL+ K Y +
Sbjct: 18  KCTVSNVSLHSLKNKRSGASLQVGILDSLVFKCYNL 53


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
            candidate 46 protein.
          Length = 1451

 Score = 20.6 bits (41), Expect = 7.1
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -2

Query: 304  VCWSTLSNC 278
            +CW+ L NC
Sbjct: 1123 ICWNVLLNC 1131


>AM292362-1|CAL23174.2|  398|Tribolium castaneum gustatory receptor
           candidate 41 protein.
          Length = 398

 Score = 20.2 bits (40), Expect = 9.4
 Identities = 5/7 (71%), Positives = 6/7 (85%)
 Frame = +2

Query: 251 GCCCLWS 271
           GC C+WS
Sbjct: 53  GCLCIWS 59


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 94,798
Number of Sequences: 336
Number of extensions: 1639
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 52
effective length of database: 105,113
effective search space used: 10195961
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -