BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_C05 (403 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1906.03 |wtf19||wtf element Wtf19|Schizosaccharomyces pombe|... 25 5.8 SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomy... 24 7.7 >SPCC1906.03 |wtf19||wtf element Wtf19|Schizosaccharomyces pombe|chr 3|||Manual Length = 393 Score = 24.6 bits (51), Expect = 5.8 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +2 Query: 44 IIFVKADVKCRSDEYTPGSQLWTRTNMRTLVAHIRTRSILAIAGVN 181 ++F+ +V + PG+ + TR ++R +A I + AI G N Sbjct: 332 VLFIMGNVLFLCEMECPGALIRTRNSIRNGIAFILEGAGRAIRGAN 377 >SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 2052 Score = 24.2 bits (50), Expect = 7.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 91 CILITSAFHVSFHENNET 38 C+L FH + HE +ET Sbjct: 120 CVLCAPCFHATNHEGHET 137 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,342,518 Number of Sequences: 5004 Number of extensions: 23364 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 136158338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -