BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_C03 (616 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 23 1.8 M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-... 22 5.5 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 22 5.5 AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. 22 5.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 5.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 5.5 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 7.2 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 7.2 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 23.4 bits (48), Expect = 1.8 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -3 Query: 290 LLPAPQNSAARTHQTLSARIVGSHPLSLSFCPSRKYGSLG 171 L+ P + + H + A V + LSLS P +GS G Sbjct: 2 LVARPMQALSIRHAVILASFVWIYALSLSLPPLFGWGSYG 41 >M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H55. ). Length = 86 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = +3 Query: 162 VCLTQRSVFSTWAKRERQWMTSH 230 +CLT+R + + R +W H Sbjct: 45 LCLTERQIKIWFQNRRMKWKKEH 67 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 21.8 bits (44), Expect = 5.5 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +2 Query: 83 QWGADQRKECYRYC 124 QW ++ +CY YC Sbjct: 62 QWPETRQLKCYMYC 75 >AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. Length = 50 Score = 21.8 bits (44), Expect = 5.5 Identities = 5/18 (27%), Positives = 12/18 (66%) Frame = +3 Query: 450 PRHSSACAYWTAHYVCTL 503 P+ + YW+ +++CT+ Sbjct: 31 PKDHNGSIYWSMYHLCTV 48 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 87 HCVLHKATPVRIPAARGSTI 28 HC +H TPV + +G I Sbjct: 828 HCEVHGDTPVTVTWLKGGKI 847 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 87 HCVLHKATPVRIPAARGSTI 28 HC +H TPV + +G I Sbjct: 824 HCEVHGDTPVTVTWLKGGKI 843 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/28 (28%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -3 Query: 131 YSYNI-DNILSAGRRPIVFSTKRHLSEF 51 +++N+ D +L + PI+ + + HL+E+ Sbjct: 163 WTHNVLDMVLYWDQEPIILADELHLTEY 190 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 7.2 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 10 AVAALXNSGSPG-CRNSDRCRFVENTMGRRPAERMLSI 120 AV AL +S P C R+V+N +G ER+L + Sbjct: 607 AVFALGSSAYPNFCAFG---RYVDNLLGELGGERLLKL 641 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,863 Number of Sequences: 438 Number of extensions: 4414 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -