BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_B24 (356 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44405| Best HMM Match : Extensin_2 (HMM E-Value=4.5) 29 1.1 SB_47424| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.5 SB_13715| Best HMM Match : Peptidase_A17 (HMM E-Value=3.6e-10) 27 4.5 >SB_44405| Best HMM Match : Extensin_2 (HMM E-Value=4.5) Length = 325 Score = 29.1 bits (62), Expect = 1.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 85 TLAAPTHHCYHYHPS 41 TLA P H+ YH+HPS Sbjct: 250 TLATPCHYHYHHHPS 264 >SB_47424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.1 bits (57), Expect = 4.5 Identities = 16/62 (25%), Positives = 24/62 (38%) Frame = -2 Query: 232 TSKMNSVESIVRFSDVSMGAAHRKSRGRSASPEAAXXXXXXXXXXX*LMTLAAPTHHCYH 53 TS N + S+V A R + + S E + LA+ HHC+H Sbjct: 79 TSSTNYQDMAANSSEVDAQALVRHGQASACSEERGDGQRQAYKYLIEI--LASAKHHCHH 136 Query: 52 YH 47 +H Sbjct: 137 HH 138 >SB_13715| Best HMM Match : Peptidase_A17 (HMM E-Value=3.6e-10) Length = 596 Score = 27.1 bits (57), Expect = 4.5 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 3/37 (8%) Frame = -1 Query: 233 HFKNEFCRKYSQI*RCFHG-RGSSKE--SRQERVARS 132 HF + ++Y RCFHG G+S E SR+E ++RS Sbjct: 554 HFWQRWKQEYLTSLRCFHGATGASGEHASRKETLSRS 590 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,816,514 Number of Sequences: 59808 Number of extensions: 196157 Number of successful extensions: 488 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 560496285 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -