BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_B17 (107 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 20 2.7 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 19 4.7 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 19.8 bits (39), Expect = 2.7 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -1 Query: 56 TSPRSVCRVPPSCR 15 +SPRS+ P +CR Sbjct: 64 SSPRSISEDPLNCR 77 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 19.0 bits (37), Expect = 4.7 Identities = 7/30 (23%), Positives = 16/30 (53%) Frame = +1 Query: 13 ILHDGGTRHTERGLVTRTRTLIMQLLRDNL 102 ++H G T+ ++ +TR + + +NL Sbjct: 182 MVHQGETQFVAANVILKTRFKTINNILENL 211 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,205 Number of Sequences: 336 Number of extensions: 190 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 16 effective length of database: 117,209 effective search space used: 2226971 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 34 (18.5 bits)
- SilkBase 1999-2023 -