BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_B17 (107 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0036 + 19474848-19475188,19475696-19475774,19475880-194760... 27 2.2 08_02_1026 + 23743186-23743686,23743793-23743915,23744734-237448... 27 2.2 08_02_0753 - 20805672-20805731,20805825-20805941,20806394-208065... 27 2.2 04_04_0141 + 23079516-23079925,23080006-23080084,23080204-230803... 27 2.2 03_05_0881 + 28461857-28462263,28462357-28462435,28462798-284629... 27 2.2 02_04_0360 + 22353057-22353691,22354716-22355144,22355233-223553... 27 2.2 02_05_1293 - 35520733-35520963,35521696-35521878,35522040-355222... 26 5.0 01_01_0767 + 5931031-5931281,5931414-5931594,5932020-5932129,593... 25 8.7 >11_06_0036 + 19474848-19475188,19475696-19475774,19475880-19476002, 19476970-19477086,19477169-19477228 Length = 239 Score = 27.1 bits (57), Expect = 2.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 70 TLIMQLLRDNLT 105 TLIMQLLRDNLT Sbjct: 202 TLIMQLLRDNLT 213 >08_02_1026 + 23743186-23743686,23743793-23743915,23744734-23744850, 23744948-23745001 Length = 264 Score = 27.1 bits (57), Expect = 2.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 70 TLIMQLLRDNLT 105 TLIMQLLRDNLT Sbjct: 229 TLIMQLLRDNLT 240 >08_02_0753 - 20805672-20805731,20805825-20805941,20806394-20806516, 20806700-20806778,20806867-20807258 Length = 256 Score = 27.1 bits (57), Expect = 2.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 70 TLIMQLLRDNLT 105 TLIMQLLRDNLT Sbjct: 219 TLIMQLLRDNLT 230 >04_04_0141 + 23079516-23079925,23080006-23080084,23080204-23080326, 23081655-23081771,23081886-23081945 Length = 262 Score = 27.1 bits (57), Expect = 2.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 70 TLIMQLLRDNLT 105 TLIMQLLRDNLT Sbjct: 225 TLIMQLLRDNLT 236 >03_05_0881 + 28461857-28462263,28462357-28462435,28462798-28462920, 28463632-28463748,28463861-28463917 Length = 260 Score = 27.1 bits (57), Expect = 2.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 70 TLIMQLLRDNLT 105 TLIMQLLRDNLT Sbjct: 224 TLIMQLLRDNLT 235 >02_04_0360 + 22353057-22353691,22354716-22355144,22355233-22355311, 22355472-22355594,22356256-22356372,22356636-22356833 Length = 526 Score = 27.1 bits (57), Expect = 2.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 70 TLIMQLLRDNLT 105 TLIMQLLRDNLT Sbjct: 443 TLIMQLLRDNLT 454 >02_05_1293 - 35520733-35520963,35521696-35521878,35522040-35522255, 35522936-35523022,35523125-35523331,35523426-35523650, 35523743-35523798,35524009-35524115,35524443-35525470 Length = 779 Score = 25.8 bits (54), Expect = 5.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 1 WXAGILHDGGTRHTERGLVTRTRTLIMQLLRDNL 102 W +H+ RH ERGL+ + L + LR + Sbjct: 15 WQHKRMHEKLARHKERGLLRHEKQLYLARLRSEI 48 >01_01_0767 + 5931031-5931281,5931414-5931594,5932020-5932129, 5932212-5932360,5932686-5932738,5933168-5933260 Length = 278 Score = 25.0 bits (52), Expect = 8.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 70 TLIMQLLRDNL 102 TLIMQLLRDNL Sbjct: 209 TLIMQLLRDNL 219 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,692,517 Number of Sequences: 37544 Number of extensions: 22626 Number of successful extensions: 76 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 14,793,348 effective HSP length: 16 effective length of database: 14,192,644 effective search space used: 269660236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -