BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_B11 (322 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23484-3|AAK68298.1| 126|Caenorhabditis elegans Sr protein (spl... 81 2e-16 U23484-2|AAC46767.1| 196|Caenorhabditis elegans Sr protein (spl... 81 2e-16 U23484-11|AAC46764.2| 191|Caenorhabditis elegans Hypothetical p... 34 0.020 U23484-10|AAC46772.1| 197|Caenorhabditis elegans Hypothetical p... 33 0.061 AF038623-4|AAO91699.1| 177|Caenorhabditis elegans Hypothetical ... 33 0.061 U41531-7|AAA83161.2| 415|Caenorhabditis elegans Feminizing gene... 31 0.24 U14946-1|AAA67723.1| 415|Caenorhabditis elegans ribonucleoprote... 31 0.24 Z81037-3|CAB02750.1| 205|Caenorhabditis elegans Hypothetical pr... 30 0.32 Z83127-4|CAB05631.1| 872|Caenorhabditis elegans Hypothetical pr... 30 0.43 Z97628-2|CAB10726.2| 427|Caenorhabditis elegans Hypothetical pr... 29 0.75 Z81080-5|CAB03088.2| 427|Caenorhabditis elegans Hypothetical pr... 29 0.75 Z81080-2|CAD56584.1| 358|Caenorhabditis elegans Hypothetical pr... 29 0.75 Z81473-3|CAB03896.4| 514|Caenorhabditis elegans Hypothetical pr... 29 0.99 AY342388-1|AAQ19851.1| 514|Caenorhabditis elegans putative RNA-... 29 0.99 AF047662-1|AAC04442.1| 248|Caenorhabditis elegans Suppressor pr... 28 1.7 Z78419-2|CAB01702.1| 154|Caenorhabditis elegans Hypothetical pr... 27 2.3 Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical pr... 27 3.0 AC084197-11|AAM44397.1| 305|Caenorhabditis elegans Homologous t... 27 4.0 AC084197-10|AAY43984.1| 308|Caenorhabditis elegans Homologous t... 27 4.0 Z72502-5|CAA96590.1| 193|Caenorhabditis elegans Hypothetical pr... 26 7.0 Z36752-6|CAA85327.1| 456|Caenorhabditis elegans Hypothetical pr... 26 7.0 U23450-2|AAK31468.1| 302|Caenorhabditis elegans Hypothetical pr... 26 7.0 U80455-1|AAB37881.1| 584|Caenorhabditis elegans Elav-type rna b... 25 9.2 U53931-1|AAA98566.1| 584|Caenorhabditis elegans elav-type ribon... 25 9.2 U41994-8|AAK31524.1| 752|Caenorhabditis elegans Hypothetical pr... 25 9.2 U41510-1|ABP49525.1| 327|Caenorhabditis elegans Hypothetical pr... 25 9.2 U39667-1|AAC69010.1| 188|Caenorhabditis elegans Hypothetical pr... 25 9.2 EF523770-1|ABS18836.1| 513|Caenorhabditis elegans ELAV-type RNA... 25 9.2 EF523769-1|ABS18835.1| 327|Caenorhabditis elegans ELAV-type RNA... 25 9.2 EF523768-1|ABS18834.1| 378|Caenorhabditis elegans ELAV-type RNA... 25 9.2 EF523767-1|ABS18833.1| 193|Caenorhabditis elegans ELAV-type RNA... 25 9.2 EF523766-1|ABS18832.1| 584|Caenorhabditis elegans ELAV-type RNA... 25 9.2 >U23484-3|AAK68298.1| 126|Caenorhabditis elegans Sr protein (splicing factor) protein4, isoform b protein. Length = 126 Score = 80.6 bits (190), Expect = 2e-16 Identities = 35/69 (50%), Positives = 47/69 (68%) Frame = +3 Query: 108 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESXXXXXXXXXX 287 R P I+G+ SLK+DNL+Y+TTP DLRR FER G++GD++IPRD+Y+R+S Sbjct: 10 RAAPDINGLTSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYE 69 Query: 288 XXXXEEALD 314 E ALD Sbjct: 70 RRDAEHALD 78 >U23484-2|AAC46767.1| 196|Caenorhabditis elegans Sr protein (splicing factor) protein4, isoform a protein. Length = 196 Score = 80.6 bits (190), Expect = 2e-16 Identities = 35/69 (50%), Positives = 47/69 (68%) Frame = +3 Query: 108 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESXXXXXXXXXX 287 R P I+G+ SLK+DNL+Y+TTP DLRR FER G++GD++IPRD+Y+R+S Sbjct: 10 RAAPDINGLTSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYE 69 Query: 288 XXXXEEALD 314 E ALD Sbjct: 70 RRDAEHALD 78 >U23484-11|AAC46764.2| 191|Caenorhabditis elegans Hypothetical protein EEED8.4 protein. Length = 191 Score = 34.3 bits (75), Expect = 0.020 Identities = 14/58 (24%), Positives = 29/58 (50%) Frame = +3 Query: 138 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESXXXXXXXXXXXXXXEEAL 311 S+ + N+ + +T E++ F+ CG++ IP+D++T++ E AL Sbjct: 56 SVFIGNVDFNSTIEEIEEHFKGCGQIVKTTIPKDKFTKKQKNFAYIEFDDSSSIENAL 113 >U23484-10|AAC46772.1| 197|Caenorhabditis elegans Hypothetical protein EEED8.12 protein. Length = 197 Score = 32.7 bits (71), Expect = 0.061 Identities = 14/58 (24%), Positives = 28/58 (48%) Frame = +3 Query: 138 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESXXXXXXXXXXXXXXEEAL 311 S+ + N+ + +T E++ F+ CG + IP+D++T++ E AL Sbjct: 62 SVFIGNVDFNSTIEEVEEHFKGCGHIVRTTIPKDKFTKKQKNFAYIEFDDSSSIENAL 119 >AF038623-4|AAO91699.1| 177|Caenorhabditis elegans Hypothetical protein T08B6.5 protein. Length = 177 Score = 32.7 bits (71), Expect = 0.061 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +3 Query: 138 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYT 248 S+ V N+ +++T ++ F CG+V + IP+D++T Sbjct: 47 SVYVGNVDWKSTVSEIEEHFAVCGKVARVTIPKDKFT 83 >U41531-7|AAA83161.2| 415|Caenorhabditis elegans Feminizing gene on x protein 1 protein. Length = 415 Score = 30.7 bits (66), Expect = 0.24 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 126 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYI 230 DG L V N+ +R DL+ +FE+ G V D+ I Sbjct: 150 DGPKRLHVSNIPFRFRDPDLKTMFEKFGVVSDVEI 184 >U14946-1|AAA67723.1| 415|Caenorhabditis elegans ribonucleoprotein protein. Length = 415 Score = 30.7 bits (66), Expect = 0.24 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 126 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYI 230 DG L V N+ +R DL+ +FE+ G V D+ I Sbjct: 150 DGPKRLHVSNIPFRFRDPDLKTMFEKFGVVSDVEI 184 >Z81037-3|CAB02750.1| 205|Caenorhabditis elegans Hypothetical protein C17E4.5 protein. Length = 205 Score = 30.3 bits (65), Expect = 0.32 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 138 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYT 248 S+ V N+ Y T E++ + F CG V + I DR++ Sbjct: 79 SVYVGNVDYGATAEEIEQHFHGCGSVSRVTIQCDRFS 115 >Z83127-4|CAB05631.1| 872|Caenorhabditis elegans Hypothetical protein T23F6.4 protein. Length = 872 Score = 29.9 bits (64), Expect = 0.43 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +3 Query: 153 NLTYRTTPEDLRRVFERCGEVGDIYIPRDRYT 248 NL Y T +DL+ +F++ GEV ++ + D+ T Sbjct: 285 NLPYATKEDDLQFLFKKYGEVSEVQVVIDKKT 316 >Z97628-2|CAB10726.2| 427|Caenorhabditis elegans Hypothetical protein F39H2.2a protein. Length = 427 Score = 29.1 bits (62), Expect = 0.75 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 168 TTPEDLRRVFERCGEVGDIYIPRDRYTRES 257 TT EDL +F R G++ + I RDR + +S Sbjct: 252 TTDEDLEIIFSRFGKINNCEIVRDRRSGDS 281 >Z81080-5|CAB03088.2| 427|Caenorhabditis elegans Hypothetical protein F39H2.2a protein. Length = 427 Score = 29.1 bits (62), Expect = 0.75 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 168 TTPEDLRRVFERCGEVGDIYIPRDRYTRES 257 TT EDL +F R G++ + I RDR + +S Sbjct: 252 TTDEDLEIIFSRFGKINNCEIVRDRRSGDS 281 >Z81080-2|CAD56584.1| 358|Caenorhabditis elegans Hypothetical protein F39H2.2b protein. Length = 358 Score = 29.1 bits (62), Expect = 0.75 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 168 TTPEDLRRVFERCGEVGDIYIPRDRYTRES 257 TT EDL +F R G++ + I RDR + +S Sbjct: 183 TTDEDLEIIFSRFGKINNCEIVRDRRSGDS 212 >Z81473-3|CAB03896.4| 514|Caenorhabditis elegans Hypothetical protein C17D12.2 protein. Length = 514 Score = 28.7 bits (61), Expect = 0.99 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 114 PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYT 248 P + + L V + +DLR +FE+ G++ + I +D+YT Sbjct: 22 PVKDPDAIKLFVGQIPRNLEEKDLRHLFEQFGKIYEFTILKDKYT 66 >AY342388-1|AAQ19851.1| 514|Caenorhabditis elegans putative RNA-binding protein protein. Length = 514 Score = 28.7 bits (61), Expect = 0.99 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 114 PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYT 248 P + + L V + +DLR +FE+ G++ + I +D+YT Sbjct: 22 PVKDPDAIKLFVGQIPRNLEEKDLRHLFEQFGKIYEFTILKDKYT 66 >AF047662-1|AAC04442.1| 248|Caenorhabditis elegans Suppressor protein 12 protein. Length = 248 Score = 27.9 bits (59), Expect = 1.7 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 147 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRES 257 V L Y T+ + L FE+ G++ + + DR T++S Sbjct: 39 VGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKS 75 >Z78419-2|CAB01702.1| 154|Caenorhabditis elegans Hypothetical protein F26A3.2 protein. Length = 154 Score = 27.5 bits (58), Expect = 2.3 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +3 Query: 138 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTR 251 +L V NL+Y T + + +F R G+V + + DR+ + Sbjct: 38 TLYVGNLSYYTKEDQVYELFGRAGDVRRVIMGLDRFKK 75 >Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical protein C18D11.4 protein. Length = 309 Score = 27.1 bits (57), Expect = 3.0 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 141 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDR 242 L V NL+ TT +DLR VF GE+ + DR Sbjct: 78 LGVFNLSSYTTEKDLRDVFGEFGEINKCDLVYDR 111 >AC084197-11|AAM44397.1| 305|Caenorhabditis elegans Homologous to drosophila sqd (squid)protein protein 1, isoform a protein. Length = 305 Score = 26.6 bits (56), Expect = 4.0 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 177 EDLRRVFERCGEVGDIYIPRDRYTR 251 +DLR FE+ G+V DI P D+ T+ Sbjct: 124 QDLRSHFEQFGKVDDIEWPFDKQTK 148 >AC084197-10|AAY43984.1| 308|Caenorhabditis elegans Homologous to drosophila sqd (squid)protein protein 1, isoform b protein. Length = 308 Score = 26.6 bits (56), Expect = 4.0 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 177 EDLRRVFERCGEVGDIYIPRDRYTR 251 +DLR FE+ G+V DI P D+ T+ Sbjct: 124 QDLRSHFEQFGKVDDIEWPFDKQTK 148 >Z72502-5|CAA96590.1| 193|Caenorhabditis elegans Hypothetical protein C08B6.8 protein. Length = 193 Score = 25.8 bits (54), Expect = 7.0 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 202 DAERSVISTYPEIVTHEKVEVL 267 D+E + I+T P+IV H+ EVL Sbjct: 41 DSELNTIATGPDIVIHQPKEVL 62 >Z36752-6|CAA85327.1| 456|Caenorhabditis elegans Hypothetical protein F35H8.5 protein. Length = 456 Score = 25.8 bits (54), Expect = 7.0 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +3 Query: 126 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRES 257 + +L ++ L T E++R +F GE+ + RD+ T +S Sbjct: 39 ESKTNLIINYLPQGMTQEEVRSLFTSIGEIESCKLVRDKVTGQS 82 >U23450-2|AAK31468.1| 302|Caenorhabditis elegans Hypothetical protein C30B5.4 protein. Length = 302 Score = 25.8 bits (54), Expect = 7.0 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +3 Query: 147 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRES 257 + L+Y + D+ VF + GEV +I + RD+ T +S Sbjct: 42 IGGLSYALSEGDVIAVFSQYGEVMNINLIRDKDTGKS 78 >U80455-1|AAB37881.1| 584|Caenorhabditis elegans Elav-type rna binding protein familyprotein 1, isoform a protein. Length = 584 Score = 25.4 bits (53), Expect = 9.2 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 135 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRES 257 + + V + + D RR+FE+ G V I RD+ T+ S Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQAS 95 >U53931-1|AAA98566.1| 584|Caenorhabditis elegans elav-type ribonucleoprotein protein. Length = 584 Score = 25.4 bits (53), Expect = 9.2 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 135 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRES 257 + + V + + D RR+FE+ G V I RD+ T+ S Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQAS 95 >U41994-8|AAK31524.1| 752|Caenorhabditis elegans Hypothetical protein F59A6.4 protein. Length = 752 Score = 25.4 bits (53), Expect = 9.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 120 RIDGMVSLKVDNLTYRTTPE 179 R+ G+VS VDN+ Y TTP+ Sbjct: 683 RLKGLVSY-VDNMQYETTPD 701 >U41510-1|ABP49525.1| 327|Caenorhabditis elegans Hypothetical protein ZC449.6 protein. Length = 327 Score = 25.4 bits (53), Expect = 9.2 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -2 Query: 309 GLLQHLGGQRILRKQNLYFLVCNDLWVCRYHRPLRIFQIRDGD 181 GL HL Q + +K+ + V L V HR +++ I DG+ Sbjct: 196 GLALHLANQELSKKEGSHGEVSQILKVLNVHR-FQVYFITDGE 237 >U39667-1|AAC69010.1| 188|Caenorhabditis elegans Hypothetical protein C18A11.6 protein. Length = 188 Score = 25.4 bits (53), Expect = 9.2 Identities = 15/53 (28%), Positives = 26/53 (49%) Frame = -2 Query: 231 VCRYHRPLRIFQIRDGDLQESSDKLNCPLLVKPCRQYAAAAFRNSF*LLVQIF 73 +C Y R +R+ ++R LQES + + + Y + F S L +QI+ Sbjct: 136 LCHYSRNVRLHRLRYLGLQESGYGILSGIQLAIATYYRISRFLTSNQLWIQIY 188 >EF523770-1|ABS18836.1| 513|Caenorhabditis elegans ELAV-type RNA binding protein variantE protein. Length = 513 Score = 25.4 bits (53), Expect = 9.2 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 135 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRES 257 + + V + + D RR+FE+ G V I RD+ T+ S Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQAS 95 >EF523769-1|ABS18835.1| 327|Caenorhabditis elegans ELAV-type RNA binding protein variantD protein. Length = 327 Score = 25.4 bits (53), Expect = 9.2 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 135 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRES 257 + + V + + D RR+FE+ G V I RD+ T+ S Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQAS 95 >EF523768-1|ABS18834.1| 378|Caenorhabditis elegans ELAV-type RNA binding protein variantC protein. Length = 378 Score = 25.4 bits (53), Expect = 9.2 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 135 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRES 257 + + V + + D RR+FE+ G V I RD+ T+ S Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQAS 95 >EF523767-1|ABS18833.1| 193|Caenorhabditis elegans ELAV-type RNA binding protein variantB protein. Length = 193 Score = 25.4 bits (53), Expect = 9.2 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 135 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRES 257 + + V + + D RR+FE+ G V I RD+ T+ S Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQAS 95 >EF523766-1|ABS18832.1| 584|Caenorhabditis elegans ELAV-type RNA binding protein variantA protein. Length = 584 Score = 25.4 bits (53), Expect = 9.2 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 135 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRES 257 + + V + + D RR+FE+ G V I RD+ T+ S Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQAS 95 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,461,742 Number of Sequences: 27780 Number of extensions: 112369 Number of successful extensions: 360 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 360 length of database: 12,740,198 effective HSP length: 71 effective length of database: 10,767,818 effective search space used: 376873630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -