BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_B10 (417 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 25 0.30 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 25 0.30 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 25 0.30 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 25 0.30 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 3.6 AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 21 4.8 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 20 8.4 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 25.0 bits (52), Expect = 0.30 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -2 Query: 110 EVQSRFAHSKAFFYFLLLILKCLVF--NLLF*LLSK 9 +++ S+ F Y + + KCL+F ++LF LL K Sbjct: 286 KIKENLEQSRYFIYMFVSVWKCLLFFVSVLFILLVK 321 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 25.0 bits (52), Expect = 0.30 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -2 Query: 110 EVQSRFAHSKAFFYFLLLILKCLVF--NLLF*LLSK 9 +++ S+ F Y + + KCL+F ++LF LL K Sbjct: 286 KIKENLEQSRYFIYMFVSVWKCLLFFVSVLFILLVK 321 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 25.0 bits (52), Expect = 0.30 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -2 Query: 110 EVQSRFAHSKAFFYFLLLILKCLVF--NLLF*LLSK 9 +++ S+ F Y + + KCL+F ++LF LL K Sbjct: 286 KIKENLEQSRYFIYMFVSVWKCLLFFVSVLFILLVK 321 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 25.0 bits (52), Expect = 0.30 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -2 Query: 110 EVQSRFAHSKAFFYFLLLILKCLVF--NLLF*LLSK 9 +++ S+ F Y + + KCL+F ++LF LL K Sbjct: 286 KIKENLEQSRYFIYMFVSVWKCLLFFVSVLFILLVK 321 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.4 bits (43), Expect = 3.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 362 FFFFAIYLSFLAFTI 318 FFFFAI F+A + Sbjct: 75 FFFFAICCDFIALIV 89 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 21.0 bits (42), Expect = 4.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 Query: 336 GKIYCKKKERYLLFPMIFLTFI 401 G YC Y +FP+ L FI Sbjct: 179 GNPYCFNSSVYKVFPVEHLLFI 200 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 20.2 bits (40), Expect = 8.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +1 Query: 151 NDFCLNNILFNFRYIIMKNILYYLEFI 231 N+ NN++ R+ K LYY +I Sbjct: 159 NNLNKNNVVATGRFTFHKKNLYYSFYI 185 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,369 Number of Sequences: 336 Number of extensions: 1342 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9174063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -