BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_B10 (417 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPJ4664.06 |gpt1||UDP-glucose-glycoprotein glucosyltransferase... 26 2.0 SPAC1093.03 |||inositol polyphosphate phosphatase |Schizosacchar... 25 4.7 >SPBPJ4664.06 |gpt1||UDP-glucose-glycoprotein glucosyltransferase Gpt1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1448 Score = 26.2 bits (55), Expect = 2.0 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -3 Query: 346 YIFPSLLLQYISEVNFVKSFKINVSFKI-NYNDSYFTNKI*ILSNIVYF 203 Y ++L+Q S+ F KS + K+ N +S+ T+ I +LSN+ YF Sbjct: 1017 YELKNILVQGYSQEEFRKSPPRGMQLKLGNLTNSHVTDTI-VLSNLGYF 1064 >SPAC1093.03 |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 832 Score = 25.0 bits (52), Expect = 4.7 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = +1 Query: 82 LECANLLCTSMYVSFIIFLCY*FNDFCLNNILFNFRYIIMKNILYYLEF 228 L C N C S+ I F F++ N + +F +++ N++ L F Sbjct: 586 LRCKNAYCDSIQRKGIKFPANYFDNVYTPNSISSFSEVLLPNLISTLNF 634 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,242,607 Number of Sequences: 5004 Number of extensions: 17843 Number of successful extensions: 53 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 146319408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -