BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_B07 (451 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 21 4.0 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 21 4.0 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 21 5.4 DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory pro... 21 7.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.1 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.4 bits (43), Expect = 4.0 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -3 Query: 329 AIFSRTCSANVLWPTSLARSAAKRRDSGF*DLPSIIEA 216 A+++R L+ +L+ + R+D+ DLPS IE+ Sbjct: 111 AVYARDRVNPYLFSYALSVAILHRQDTQDIDLPSFIES 148 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.4 bits (43), Expect = 4.0 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +1 Query: 286 VGHNTFAEHVLEKIAQIKLEQAENSDD 366 +GH H EKI + + E ++ DD Sbjct: 266 LGHTLSMNHKYEKIDKEEHESMDDDDD 292 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 21.0 bits (42), Expect = 5.4 Identities = 11/46 (23%), Positives = 22/46 (47%) Frame = +1 Query: 31 VKGAVKTLAEARLFKEAYILCRIRYMDSIAEEMLGTWASECDTIGN 168 ++ ++ T+ +L K + RY+D + + A + D IGN Sbjct: 119 LRKSIPTMPSDKLSKIQTLKLAARYIDFLYHVLSNENALDVDLIGN 164 >DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory protein 5 protein. Length = 144 Score = 20.6 bits (41), Expect = 7.1 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = +1 Query: 376 KLTSRADAIATTGEEYQIEDDYN 444 +L ++ D ++Y+I+DDY+ Sbjct: 113 QLVAKYDPDGIYRKQYEIDDDYD 135 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 7.1 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = +2 Query: 95 ELGTWIA*LKRC 130 E+GTWI +++C Sbjct: 133 EVGTWIRAVRKC 144 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 7.1 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = +2 Query: 95 ELGTWIA*LKRC 130 E+GTWI +++C Sbjct: 133 EVGTWIRAVRKC 144 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.315 0.130 0.363 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,983 Number of Sequences: 336 Number of extensions: 1967 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.1 bits)
- SilkBase 1999-2023 -