BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_B05 (202 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY089264-1|AAL90002.1| 580|Drosophila melanogaster AT05239p pro... 30 0.51 AE014298-2321|AAF48559.2| 580|Drosophila melanogaster CG12698-P... 30 0.51 >AY089264-1|AAL90002.1| 580|Drosophila melanogaster AT05239p protein. Length = 580 Score = 29.9 bits (64), Expect = 0.51 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 26 GRCSGCSALGAPVQRTIWYIVVIYCKLIYISNTLHKYLIL 145 G C G + RT YI YC+L+ I NT +K ++L Sbjct: 166 GDCIGDIDVMEDTPRTNTYIATTYCELLAIFNTNYKIVLL 205 >AE014298-2321|AAF48559.2| 580|Drosophila melanogaster CG12698-PA protein. Length = 580 Score = 29.9 bits (64), Expect = 0.51 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 26 GRCSGCSALGAPVQRTIWYIVVIYCKLIYISNTLHKYLIL 145 G C G + RT YI YC+L+ I NT +K ++L Sbjct: 166 GDCIGDIDVMEDTPRTNTYIATTYCELLAIFNTNYKIVLL 205 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,053,944 Number of Sequences: 53049 Number of extensions: 139438 Number of successful extensions: 308 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 305 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 308 length of database: 24,988,368 effective HSP length: 46 effective length of database: 22,548,114 effective search space used: 450962280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -